FuNGI

G0SXU7

Protein Details

Accession

G0SXU7

Localization Confidence

Medium

Confidence Score

14.2

NoLS Segment(s)

Position	Sequence	Protein Nature
536-566	GGRRGKTEEERERERRERRERGKPGSVRYRF	Basic

NLS Segment(s)

Position	Sequence
519-523	KEREK
530-562	AAGGAAGGRRGKTEEERERERRERRERGKPGSV

Subcellular Location(s)

nucl 16, cyto_nucl 12.5, cyto 7, mito 3

Family & Domain DBs

InterPro	View protein in InterPro IPR013763 Cyclin-like_dom IPR036915 Cyclin-like_sf IPR043198 Cyclin/Ssn8 IPR006671 Cyclin_N
Gene Ontology	GO:0016538 F:cyclin-dependent protein serine/threonine kinase regulator activity GO:0006357 P:regulation of transcription by RNA polymerase II
Pfam	View protein in Pfam PF00134 Cyclin_N

Amino Acid Sequences

MAQLAGVPEPRPPRNPDSPPPLAVTRSFRPFYSPIEVEHLVHLQAQSRASASGGADGPAGEASGGLARKTMSDQRIESLRQLACGFIERVAGRLGFPRRTTATAQKLYHRFHLHFPLSDFAYQDVSLSALLVSAKLEDTLKKLRDIQIAAWKVQNMMDGGSGVGEGDPNTQEAHRPHLIGIERLILQTICFNFNLNRPLDSSPSAPSLPSDTDSLLTLATLSPSASAATSRDAFTHLLRLSSAIPSVPSALVRPSSPSTDSSLVEEVHKSLTYAAFLLLTDLHRTLAPLSYPPHTCAAACIWTAGFVLATAAARRKVENGSENGTGEKDEVVWDEDMLQGWAASCETLEADIDDIAQTLLNLLISLCPPQPTSASATANGLSVPLTTSPLFSPVSPAETSQSSSSTGAAKPVATSERDRHLLQTGVPTVFSHPDLLSQPISANDLMGVKIQLRKARAAAAANGKRDREEAGAAVEQGDDVTLHRSKRWQGLSDGLAEVGRIRDERDQKDRLRAEEKAEKEREKSENDASAAGGAAGGRRGKTEEERERERRERRERGKPGSVRYRF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.55
2	0.63
3	0.66
4	0.68
5	0.69
6	0.66
7	0.63
8	0.59
9	0.52
10	0.48
11	0.46
12	0.44
13	0.46
14	0.45
15	0.4
16	0.43
17	0.43
18	0.43
19	0.45
20	0.4
21	0.34
22	0.4
23	0.41
24	0.36
25	0.35
26	0.31
27	0.23
28	0.24
29	0.22
30	0.18
31	0.2
32	0.19
33	0.18
34	0.17
35	0.17
36	0.16
37	0.17
38	0.14
39	0.15
40	0.15
41	0.15
42	0.14
43	0.13
44	0.13
45	0.11
46	0.1
47	0.06
48	0.05
49	0.05
50	0.08
51	0.09
52	0.09
53	0.09
54	0.1
55	0.11
56	0.16
57	0.23
58	0.23
59	0.28
60	0.3
61	0.34
62	0.39
63	0.4
64	0.38
65	0.38
66	0.34
67	0.32
68	0.3
69	0.26
70	0.21
71	0.23
72	0.21
73	0.15
74	0.19
75	0.16
76	0.17
77	0.18
78	0.18
79	0.15
80	0.21
81	0.26
82	0.27
83	0.28
84	0.32
85	0.33
86	0.37
87	0.41
88	0.44
89	0.48
90	0.51
91	0.52
92	0.56
93	0.61
94	0.6
95	0.63
96	0.59
97	0.52
98	0.49
99	0.56
100	0.51
101	0.46
102	0.44
103	0.4
104	0.36
105	0.35
106	0.3
107	0.21
108	0.2
109	0.17
110	0.15
111	0.11
112	0.1
113	0.08
114	0.08
115	0.07
116	0.05
117	0.05
118	0.05
119	0.05
120	0.05
121	0.06
122	0.06
123	0.08
124	0.08
125	0.13
126	0.21
127	0.22
128	0.24
129	0.29
130	0.33
131	0.38
132	0.38
133	0.38
134	0.4
135	0.41
136	0.4
137	0.38
138	0.32
139	0.28
140	0.26
141	0.23
142	0.14
143	0.12
144	0.11
145	0.09
146	0.08
147	0.08
148	0.07
149	0.05
150	0.04
151	0.04
152	0.04
153	0.05
154	0.06
155	0.06
156	0.07
157	0.08
158	0.12
159	0.13
160	0.19
161	0.2
162	0.2
163	0.2
164	0.24
165	0.25
166	0.22
167	0.22
168	0.18
169	0.16
170	0.16
171	0.16
172	0.11
173	0.1
174	0.12
175	0.12
176	0.11
177	0.11
178	0.12
179	0.13
180	0.18
181	0.23
182	0.2
183	0.2
184	0.21
185	0.22
186	0.24
187	0.24
188	0.22
189	0.18
190	0.2
191	0.19
192	0.17
193	0.16
194	0.16
195	0.15
196	0.15
197	0.14
198	0.11
199	0.12
200	0.12
201	0.12
202	0.09
203	0.08
204	0.06
205	0.05
206	0.05
207	0.05
208	0.04
209	0.04
210	0.04
211	0.05
212	0.05
213	0.05
214	0.06
215	0.08
216	0.09
217	0.09
218	0.1
219	0.11
220	0.12
221	0.12
222	0.17
223	0.15
224	0.14
225	0.14
226	0.15
227	0.14
228	0.13
229	0.13
230	0.07
231	0.07
232	0.07
233	0.08
234	0.07
235	0.07
236	0.07
237	0.07
238	0.08
239	0.08
240	0.11
241	0.11
242	0.13
243	0.14
244	0.15
245	0.18
246	0.19
247	0.2
248	0.18
249	0.18
250	0.17
251	0.16
252	0.15
253	0.12
254	0.1
255	0.1
256	0.08
257	0.07
258	0.07
259	0.06
260	0.06
261	0.06
262	0.05
263	0.05
264	0.05
265	0.05
266	0.06
267	0.06
268	0.06
269	0.06
270	0.06
271	0.07
272	0.07
273	0.07
274	0.07
275	0.08
276	0.1
277	0.13
278	0.14
279	0.15
280	0.16
281	0.16
282	0.15
283	0.14
284	0.14
285	0.13
286	0.12
287	0.1
288	0.08
289	0.08
290	0.09
291	0.07
292	0.06
293	0.03
294	0.03
295	0.04
296	0.04
297	0.04
298	0.06
299	0.08
300	0.08
301	0.09
302	0.11
303	0.12
304	0.15
305	0.19
306	0.2
307	0.22
308	0.23
309	0.23
310	0.22
311	0.2
312	0.17
313	0.13
314	0.1
315	0.06
316	0.06
317	0.06
318	0.07
319	0.07
320	0.07
321	0.07
322	0.07
323	0.08
324	0.07
325	0.06
326	0.04
327	0.04
328	0.05
329	0.04
330	0.04
331	0.03
332	0.03
333	0.04
334	0.04
335	0.04
336	0.04
337	0.04
338	0.04
339	0.04
340	0.04
341	0.04
342	0.04
343	0.04
344	0.04
345	0.03
346	0.04
347	0.03
348	0.03
349	0.03
350	0.04
351	0.05
352	0.07
353	0.07
354	0.08
355	0.08
356	0.09
357	0.11
358	0.12
359	0.16
360	0.19
361	0.2
362	0.19
363	0.2
364	0.2
365	0.19
366	0.17
367	0.12
368	0.07
369	0.06
370	0.06
371	0.06
372	0.08
373	0.08
374	0.09
375	0.09
376	0.12
377	0.13
378	0.12
379	0.15
380	0.13
381	0.17
382	0.16
383	0.17
384	0.16
385	0.16
386	0.18
387	0.15
388	0.16
389	0.14
390	0.14
391	0.15
392	0.15
393	0.15
394	0.15
395	0.15
396	0.14
397	0.12
398	0.14
399	0.16
400	0.16
401	0.2
402	0.22
403	0.27
404	0.3
405	0.3
406	0.3
407	0.3
408	0.29
409	0.26
410	0.28
411	0.25
412	0.22
413	0.22
414	0.2
415	0.19
416	0.2
417	0.19
418	0.16
419	0.12
420	0.15
421	0.16
422	0.18
423	0.17
424	0.15
425	0.15
426	0.14
427	0.16
428	0.13
429	0.12
430	0.1
431	0.1
432	0.1
433	0.1
434	0.1
435	0.1
436	0.14
437	0.18
438	0.21
439	0.23
440	0.25
441	0.26
442	0.3
443	0.31
444	0.3
445	0.32
446	0.39
447	0.42
448	0.45
449	0.48
450	0.44
451	0.41
452	0.39
453	0.36
454	0.28
455	0.25
456	0.19
457	0.19
458	0.2
459	0.19
460	0.18
461	0.15
462	0.12
463	0.1
464	0.09
465	0.05
466	0.05
467	0.1
468	0.13
469	0.14
470	0.17
471	0.22
472	0.27
473	0.36
474	0.41
475	0.4
476	0.41
477	0.47
478	0.47
479	0.44
480	0.4
481	0.31
482	0.25
483	0.21
484	0.19
485	0.13
486	0.12
487	0.1
488	0.12
489	0.19
490	0.28
491	0.35
492	0.42
493	0.5
494	0.53
495	0.62
496	0.64
497	0.63
498	0.61
499	0.57
500	0.57
501	0.58
502	0.58
503	0.58
504	0.61
505	0.59
506	0.56
507	0.61
508	0.58
509	0.54
510	0.55
511	0.51
512	0.5
513	0.47
514	0.43
515	0.36
516	0.31
517	0.26
518	0.2
519	0.14
520	0.08
521	0.07
522	0.1
523	0.12
524	0.12
525	0.13
526	0.16
527	0.21
528	0.29
529	0.39
530	0.45
531	0.52
532	0.61
533	0.68
534	0.75
535	0.79
536	0.81
537	0.81
538	0.81
539	0.84
540	0.84
541	0.88
542	0.88
543	0.88
544	0.89
545	0.86
546	0.86

G0SXU7

3D AlphaFold-predicted Structure Viewer