Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RME7

Protein Details
Accession A0A2J6RME7    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-32PRNQQHGQSSNRVKKKKKKKFAADPQDVVGHydrophilic
NLS Segment(s)
PositionSequence
14-22RVKKKKKKK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000210  BTB/POZ_dom  
IPR011333  SKP1/BTB/POZ_sf  
Pfam View protein in Pfam  
PF00651  BTB  
PROSITE View protein in PROSITE  
PS50097  BTB  
CDD cd18186  BTB_POZ_ZBTB_KLHL-like  
Amino Acid Sequences MPPRNQQHGQSSNRVKKKKKKKFAADPQDVVGLYAGEDRGEKPLNIHKDVACFYSPVFKAAFNSQFIEGEEQKCRLEDTNPRTVRLLIHGSPSPCNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.8
4 0.86
5 0.87
6 0.88
7 0.89
8 0.9
9 0.93
10 0.94
11 0.95
12 0.92
13 0.82
14 0.73
15 0.64
16 0.53
17 0.42
18 0.3
19 0.19
20 0.1
21 0.09
22 0.07
23 0.05
24 0.06
25 0.06
26 0.09
27 0.1
28 0.09
29 0.11
30 0.17
31 0.22
32 0.23
33 0.25
34 0.22
35 0.23
36 0.24
37 0.24
38 0.18
39 0.13
40 0.12
41 0.17
42 0.17
43 0.16
44 0.16
45 0.14
46 0.16
47 0.2
48 0.23
49 0.18
50 0.2
51 0.19
52 0.19
53 0.2
54 0.23
55 0.2
56 0.2
57 0.21
58 0.21
59 0.21
60 0.2
61 0.21
62 0.18
63 0.21
64 0.28
65 0.32
66 0.41
67 0.42
68 0.44
69 0.44
70 0.43
71 0.39
72 0.36
73 0.36
74 0.27
75 0.31
76 0.33
77 0.34