Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RZL9

Protein Details
Accession A0A2J6RZL9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-30LLRSRFPCRPNSKQMRQHVTCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, plas 8, mito_nucl 8
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIACRRVWELLRSRFPCRPNSKQMRQHVTCLEPHELPPWIGSLQFQGSTANKSCLVSEGWNQADTSLLPRHPRLNMLKHLFFALSWEIHQCIITPRQCYIALIAVFILHGLSLSYQTQFAMMERVYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.64
3 0.65
4 0.65
5 0.64
6 0.65
7 0.71
8 0.75
9 0.79
10 0.85
11 0.85
12 0.78
13 0.75
14 0.69
15 0.62
16 0.55
17 0.5
18 0.43
19 0.34
20 0.32
21 0.29
22 0.25
23 0.22
24 0.19
25 0.16
26 0.12
27 0.11
28 0.11
29 0.1
30 0.1
31 0.1
32 0.1
33 0.11
34 0.12
35 0.15
36 0.16
37 0.16
38 0.15
39 0.15
40 0.15
41 0.14
42 0.15
43 0.13
44 0.14
45 0.17
46 0.17
47 0.17
48 0.17
49 0.15
50 0.14
51 0.12
52 0.13
53 0.1
54 0.11
55 0.13
56 0.14
57 0.17
58 0.17
59 0.23
60 0.25
61 0.3
62 0.36
63 0.4
64 0.4
65 0.38
66 0.38
67 0.32
68 0.26
69 0.23
70 0.16
71 0.11
72 0.1
73 0.11
74 0.11
75 0.11
76 0.11
77 0.1
78 0.12
79 0.18
80 0.21
81 0.22
82 0.22
83 0.25
84 0.26
85 0.25
86 0.23
87 0.23
88 0.19
89 0.18
90 0.17
91 0.13
92 0.13
93 0.12
94 0.1
95 0.03
96 0.03
97 0.03
98 0.04
99 0.06
100 0.07
101 0.08
102 0.09
103 0.09
104 0.1
105 0.1
106 0.1
107 0.13