Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RGU4

Protein Details
Accession A0A2J6RGU4    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
223-256RAGVKVKPFKPRDRWTAWKKREVRFAKNAEKRSLHydrophilic
NLS Segment(s)
PositionSequence
182-205GRKEVKVKKAKARKGEEGRDLKLR
219-263RAAERAGVKVKPFKPRDRWTAWKKREVRFAKNAEKRSLGRKIGGK
Subcellular Location(s) mito 20.5, cyto_mito 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
IPR018261  Ribosomal_L27_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
PROSITE View protein in PROSITE  
PS00831  RIBOSOMAL_L27  
Amino Acid Sequences MLLPRLQPPLRAAIASIARSAPSVQSTACLNEAFAALALKPLVFVRHASHAQQGAVNKAKDGPGKRLGAKKSGEQYVIPGNIIFRQRGTHWFPGDNCAMGRDHTIYATESGYVKYYKDPERHPKRQYIGVVFKRDQVLPLPRNSHRRRRLNMVAVKMEVPEVAEGGEVAVSGVTLEGGEGEGRKEVKVKKAKARKGEEGRDLKLRPGYMYRESNWEIGRAAERAGVKVKPFKPRDRWTAWKKREVRFAKNAEKRSLGRKIGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.28
4 0.22
5 0.21
6 0.21
7 0.22
8 0.17
9 0.14
10 0.14
11 0.13
12 0.14
13 0.16
14 0.17
15 0.18
16 0.16
17 0.14
18 0.13
19 0.14
20 0.12
21 0.1
22 0.09
23 0.07
24 0.08
25 0.08
26 0.07
27 0.07
28 0.08
29 0.09
30 0.09
31 0.11
32 0.13
33 0.2
34 0.22
35 0.23
36 0.28
37 0.28
38 0.28
39 0.29
40 0.27
41 0.27
42 0.31
43 0.3
44 0.25
45 0.25
46 0.28
47 0.31
48 0.33
49 0.33
50 0.34
51 0.38
52 0.43
53 0.48
54 0.47
55 0.48
56 0.48
57 0.47
58 0.46
59 0.45
60 0.41
61 0.34
62 0.34
63 0.32
64 0.31
65 0.25
66 0.19
67 0.16
68 0.18
69 0.2
70 0.17
71 0.12
72 0.14
73 0.15
74 0.22
75 0.27
76 0.3
77 0.3
78 0.33
79 0.33
80 0.35
81 0.34
82 0.29
83 0.22
84 0.17
85 0.16
86 0.13
87 0.14
88 0.11
89 0.11
90 0.1
91 0.11
92 0.1
93 0.11
94 0.1
95 0.1
96 0.09
97 0.09
98 0.1
99 0.1
100 0.09
101 0.11
102 0.16
103 0.21
104 0.25
105 0.31
106 0.41
107 0.51
108 0.59
109 0.61
110 0.63
111 0.6
112 0.61
113 0.57
114 0.53
115 0.53
116 0.49
117 0.51
118 0.44
119 0.44
120 0.4
121 0.36
122 0.3
123 0.24
124 0.27
125 0.24
126 0.27
127 0.3
128 0.33
129 0.43
130 0.48
131 0.55
132 0.57
133 0.63
134 0.63
135 0.67
136 0.7
137 0.7
138 0.69
139 0.63
140 0.55
141 0.47
142 0.43
143 0.35
144 0.27
145 0.17
146 0.12
147 0.07
148 0.05
149 0.05
150 0.04
151 0.04
152 0.03
153 0.03
154 0.03
155 0.03
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.03
165 0.03
166 0.03
167 0.04
168 0.06
169 0.07
170 0.08
171 0.13
172 0.16
173 0.26
174 0.35
175 0.42
176 0.5
177 0.6
178 0.67
179 0.71
180 0.76
181 0.77
182 0.77
183 0.78
184 0.77
185 0.73
186 0.69
187 0.67
188 0.6
189 0.53
190 0.47
191 0.4
192 0.33
193 0.31
194 0.33
195 0.33
196 0.37
197 0.35
198 0.39
199 0.4
200 0.42
201 0.38
202 0.34
203 0.27
204 0.24
205 0.25
206 0.19
207 0.17
208 0.16
209 0.16
210 0.17
211 0.21
212 0.21
213 0.23
214 0.32
215 0.37
216 0.43
217 0.5
218 0.57
219 0.64
220 0.7
221 0.76
222 0.75
223 0.8
224 0.81
225 0.85
226 0.84
227 0.84
228 0.83
229 0.82
230 0.83
231 0.81
232 0.79
233 0.78
234 0.79
235 0.8
236 0.81
237 0.8
238 0.75
239 0.74
240 0.68
241 0.67
242 0.66
243 0.6