Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6PF32

Protein Details
Accession A0A2J6PF32    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-22GYIRKTFRKEHETPKRSRFRCBasic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 11, mito 7.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MGYIRKTFRKEHETPKRSRFRCLLEQGYSQRDTARRLDLARGTASKWASDRRTGKGRTSKPPIISDEKVEEMIQWMTGHFDRRAMPLQEIAREHGIKASNNAILVAFARRGYHHHMPDCKPFLSEVTKRKRWTFSITNWDRPKEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.83
4 0.76
5 0.76
6 0.72
7 0.68
8 0.69
9 0.69
10 0.66
11 0.6
12 0.65
13 0.61
14 0.6
15 0.53
16 0.43
17 0.39
18 0.35
19 0.34
20 0.3
21 0.3
22 0.28
23 0.28
24 0.32
25 0.31
26 0.31
27 0.3
28 0.27
29 0.24
30 0.25
31 0.24
32 0.21
33 0.2
34 0.24
35 0.24
36 0.31
37 0.34
38 0.35
39 0.43
40 0.44
41 0.5
42 0.53
43 0.57
44 0.57
45 0.62
46 0.61
47 0.56
48 0.57
49 0.54
50 0.51
51 0.46
52 0.39
53 0.33
54 0.29
55 0.26
56 0.22
57 0.17
58 0.12
59 0.11
60 0.09
61 0.07
62 0.06
63 0.07
64 0.08
65 0.11
66 0.09
67 0.11
68 0.12
69 0.15
70 0.2
71 0.19
72 0.19
73 0.21
74 0.22
75 0.24
76 0.24
77 0.23
78 0.22
79 0.21
80 0.2
81 0.19
82 0.2
83 0.17
84 0.19
85 0.19
86 0.16
87 0.16
88 0.16
89 0.13
90 0.11
91 0.11
92 0.1
93 0.09
94 0.08
95 0.09
96 0.09
97 0.13
98 0.21
99 0.28
100 0.33
101 0.4
102 0.47
103 0.51
104 0.59
105 0.6
106 0.53
107 0.45
108 0.4
109 0.37
110 0.38
111 0.41
112 0.42
113 0.47
114 0.54
115 0.59
116 0.64
117 0.66
118 0.62
119 0.63
120 0.62
121 0.61
122 0.65
123 0.67
124 0.72
125 0.72