Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6PSN1

Protein Details
Accession A0A2J6PSN1   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
81-103VLKDNPAKKRGTKRLRANTTGKVHydrophilic
NLS Segment(s)
PositionSequence
40-44RPKKK
88-95KKRGTKRL
Subcellular Location(s) nucl 14, cyto_nucl 12.333, mito_nucl 10.499, cyto 7.5, mito 5.5
Family & Domain DBs
Amino Acid Sequences MVRSMPYEYKYEIQTEWGVVERLFPVKELKTVADQIEVRRPKKKLSLKKVAEYASSADRVIISSEHDCGFLASLALRTGLVLKDNPAKKRGTKRLRANTTGKVVEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.19
4 0.17
5 0.16
6 0.14
7 0.15
8 0.12
9 0.14
10 0.13
11 0.13
12 0.15
13 0.15
14 0.18
15 0.18
16 0.18
17 0.19
18 0.21
19 0.21
20 0.22
21 0.22
22 0.22
23 0.3
24 0.35
25 0.34
26 0.38
27 0.39
28 0.38
29 0.46
30 0.54
31 0.55
32 0.58
33 0.67
34 0.65
35 0.68
36 0.69
37 0.6
38 0.51
39 0.42
40 0.34
41 0.25
42 0.21
43 0.16
44 0.11
45 0.1
46 0.09
47 0.09
48 0.07
49 0.08
50 0.08
51 0.1
52 0.1
53 0.1
54 0.1
55 0.09
56 0.1
57 0.07
58 0.07
59 0.05
60 0.06
61 0.06
62 0.06
63 0.06
64 0.05
65 0.07
66 0.07
67 0.09
68 0.09
69 0.12
70 0.2
71 0.26
72 0.29
73 0.32
74 0.36
75 0.42
76 0.53
77 0.61
78 0.63
79 0.68
80 0.75
81 0.83
82 0.87
83 0.87
84 0.83
85 0.8
86 0.77