Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6PLS8

Protein Details
Accession A0A2J6PLS8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
102-128TVRLTEYRKARKWKNPRPKVLKEQSFYHydrophilic
NLS Segment(s)
PositionSequence
109-120RKARKWKNPRPK
Subcellular Location(s) mito 19, cyto 3, extr 2, cyto_nucl 2, pero 2
Family & Domain DBs
Amino Acid Sequences MDILARRTGARIAPAVPTVQAVLTAPPPPEASTVQAVLTAPAAPAASTVQTVITAPVAPVTSTVQAVLTVPVATKQLSPDRPEVLMQAYLAEKTAWLAQHPTVRLTEYRKARKWKNPRPKVLKEQSFYMPKERRDLNGLGVSVLEPQINGTLGYFIVLGNYTIFSGKSPDPIIRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.19
4 0.18
5 0.15
6 0.12
7 0.11
8 0.09
9 0.09
10 0.11
11 0.13
12 0.13
13 0.14
14 0.15
15 0.15
16 0.18
17 0.17
18 0.19
19 0.19
20 0.19
21 0.18
22 0.18
23 0.16
24 0.14
25 0.13
26 0.1
27 0.07
28 0.07
29 0.07
30 0.05
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.07
39 0.06
40 0.06
41 0.06
42 0.05
43 0.06
44 0.06
45 0.06
46 0.07
47 0.08
48 0.08
49 0.08
50 0.09
51 0.07
52 0.07
53 0.08
54 0.07
55 0.06
56 0.05
57 0.05
58 0.06
59 0.06
60 0.07
61 0.07
62 0.09
63 0.15
64 0.18
65 0.21
66 0.22
67 0.23
68 0.23
69 0.23
70 0.21
71 0.16
72 0.14
73 0.11
74 0.09
75 0.08
76 0.07
77 0.07
78 0.06
79 0.05
80 0.05
81 0.07
82 0.06
83 0.06
84 0.08
85 0.1
86 0.14
87 0.15
88 0.15
89 0.14
90 0.15
91 0.18
92 0.21
93 0.26
94 0.32
95 0.4
96 0.45
97 0.54
98 0.61
99 0.68
100 0.75
101 0.78
102 0.81
103 0.82
104 0.87
105 0.88
106 0.88
107 0.89
108 0.88
109 0.85
110 0.76
111 0.7
112 0.66
113 0.63
114 0.56
115 0.55
116 0.51
117 0.45
118 0.49
119 0.46
120 0.42
121 0.41
122 0.4
123 0.36
124 0.34
125 0.32
126 0.26
127 0.24
128 0.22
129 0.17
130 0.16
131 0.11
132 0.06
133 0.07
134 0.08
135 0.08
136 0.08
137 0.07
138 0.07
139 0.07
140 0.08
141 0.07
142 0.06
143 0.06
144 0.07
145 0.07
146 0.07
147 0.07
148 0.07
149 0.08
150 0.08
151 0.08
152 0.13
153 0.13
154 0.18
155 0.2