Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6PE16

Protein Details
Accession A0A2J6PE16    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
54-74GWKVWRWRSRMRRVGRVGRREBasic
NLS Segment(s)
PositionSequence
55-74WKVWRWRSRMRRVGRVGRRE
Subcellular Location(s) mito 16, nucl 5, cyto 4.5, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003162  TFIID-31  
Gene Ontology GO:0005634  C:nucleus  
GO:0006352  P:DNA-templated transcription initiation  
Pfam View protein in Pfam  
PF02291  TFIID-31kDa  
Amino Acid Sequences MSKEFLLGMAQQRNNVTLPRVLRNEWGVWLPSERFVLTGVPWGLMRRRRCREMGWKVWRWRSRMRRVGRVGRREAPWKICLAVIRIRIWRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.24
4 0.21
5 0.24
6 0.28
7 0.3
8 0.3
9 0.32
10 0.33
11 0.31
12 0.28
13 0.26
14 0.2
15 0.18
16 0.19
17 0.16
18 0.15
19 0.15
20 0.13
21 0.12
22 0.11
23 0.11
24 0.09
25 0.12
26 0.11
27 0.1
28 0.1
29 0.11
30 0.15
31 0.2
32 0.27
33 0.32
34 0.38
35 0.41
36 0.43
37 0.49
38 0.55
39 0.59
40 0.62
41 0.62
42 0.65
43 0.68
44 0.75
45 0.73
46 0.68
47 0.68
48 0.68
49 0.7
50 0.71
51 0.71
52 0.72
53 0.77
54 0.82
55 0.81
56 0.8
57 0.76
58 0.73
59 0.7
60 0.67
61 0.65
62 0.59
63 0.53
64 0.46
65 0.4
66 0.36
67 0.33
68 0.31
69 0.31
70 0.31
71 0.33