Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6PVS9

Protein Details
Accession A0A2J6PVS9    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-33RGFPPAPILRQKRPPKCPRAQPRQHDAGRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MNSRRGFPPAPILRQKRPPKCPRAQPRQHDAGRSRGGSSALLIRNHNKGPPPAFGDLQRQSSASAKTPKSKNKYLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.77
3 0.77
4 0.8
5 0.82
6 0.82
7 0.84
8 0.87
9 0.88
10 0.89
11 0.89
12 0.86
13 0.83
14 0.83
15 0.75
16 0.72
17 0.63
18 0.6
19 0.54
20 0.46
21 0.39
22 0.31
23 0.29
24 0.22
25 0.2
26 0.17
27 0.17
28 0.17
29 0.18
30 0.2
31 0.23
32 0.24
33 0.25
34 0.23
35 0.24
36 0.25
37 0.27
38 0.29
39 0.28
40 0.29
41 0.3
42 0.35
43 0.34
44 0.35
45 0.32
46 0.29
47 0.27
48 0.3
49 0.3
50 0.29
51 0.34
52 0.35
53 0.43
54 0.51
55 0.6
56 0.64