Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6PLJ1

Protein Details
Accession A0A2J6PLJ1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
195-220QEAKTSGKKEHYKKMKAMRKKSGSKGBasic
NLS Segment(s)
PositionSequence
200-220SGKKEHYKKMKAMRKKSGSKG
Subcellular Location(s) nucl 20, cyto_nucl 13.333, mito_nucl 10.833, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039883  Fcf2/DNTTIP2  
IPR014810  Fcf2_C  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08698  Fcf2  
Amino Acid Sequences MADEDLSDEQVRQLLKDAEERLRSKRAASKTSLTLQNSIPKLESGKAIEPYIKTTDQGAYVDPSHFVSPQERKLANGIRVVEDPVAIKAKAAKEKKATAGADWYNLPRTNLTPELKRDLQLLRMRDVLDPKRFYKKENSKPQIPEFSQVGTIIEGPTEYFSGRLSNKERKRTLVEEILAGEKETGRFKSKYQQIQEAKTSGKKEHYKKMKAMRKKSGSKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.25
4 0.3
5 0.34
6 0.41
7 0.44
8 0.45
9 0.48
10 0.47
11 0.46
12 0.49
13 0.5
14 0.49
15 0.51
16 0.51
17 0.5
18 0.57
19 0.59
20 0.53
21 0.48
22 0.45
23 0.47
24 0.42
25 0.38
26 0.31
27 0.26
28 0.26
29 0.24
30 0.24
31 0.2
32 0.23
33 0.24
34 0.25
35 0.27
36 0.25
37 0.27
38 0.28
39 0.25
40 0.21
41 0.2
42 0.2
43 0.19
44 0.19
45 0.16
46 0.14
47 0.15
48 0.15
49 0.14
50 0.14
51 0.13
52 0.13
53 0.13
54 0.18
55 0.21
56 0.26
57 0.32
58 0.3
59 0.3
60 0.36
61 0.4
62 0.37
63 0.36
64 0.32
65 0.27
66 0.28
67 0.28
68 0.22
69 0.17
70 0.14
71 0.11
72 0.12
73 0.1
74 0.09
75 0.12
76 0.15
77 0.23
78 0.25
79 0.29
80 0.31
81 0.34
82 0.37
83 0.4
84 0.37
85 0.29
86 0.32
87 0.28
88 0.25
89 0.23
90 0.21
91 0.18
92 0.18
93 0.17
94 0.12
95 0.13
96 0.15
97 0.19
98 0.2
99 0.21
100 0.23
101 0.28
102 0.28
103 0.28
104 0.27
105 0.22
106 0.27
107 0.28
108 0.28
109 0.24
110 0.25
111 0.25
112 0.24
113 0.3
114 0.29
115 0.31
116 0.33
117 0.34
118 0.42
119 0.42
120 0.43
121 0.48
122 0.52
123 0.56
124 0.64
125 0.68
126 0.66
127 0.71
128 0.73
129 0.71
130 0.61
131 0.55
132 0.44
133 0.39
134 0.32
135 0.26
136 0.22
137 0.13
138 0.13
139 0.09
140 0.07
141 0.06
142 0.06
143 0.06
144 0.06
145 0.06
146 0.06
147 0.06
148 0.11
149 0.12
150 0.18
151 0.24
152 0.34
153 0.41
154 0.51
155 0.53
156 0.54
157 0.6
158 0.58
159 0.58
160 0.55
161 0.49
162 0.4
163 0.39
164 0.36
165 0.29
166 0.26
167 0.19
168 0.13
169 0.14
170 0.16
171 0.17
172 0.21
173 0.22
174 0.24
175 0.34
176 0.42
177 0.49
178 0.51
179 0.59
180 0.6
181 0.65
182 0.68
183 0.62
184 0.58
185 0.55
186 0.52
187 0.46
188 0.49
189 0.52
190 0.55
191 0.61
192 0.67
193 0.7
194 0.75
195 0.82
196 0.82
197 0.84
198 0.86
199 0.87
200 0.86