Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6QLC4

Protein Details
Accession A0A2J6QLC4    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
96-139PPSLPPPSRRSRPSRKEKEPVKAKPEPKPKPSKQPMSRIKRNNGBasic
NLS Segment(s)
PositionSequence
101-140PPSRRSRPSRKEKEPVKAKPEPKPKPSKQPMSRIKRNNGP
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
Amino Acid Sequences MSSDKSDTPEKPEVPSLPGNLDNLPEYVPPRPTNLDPFHGSTRPRDAAEPSILSRNPDDPLPSLPALPPPTSHIPTTSIALFEDCPAEATPPSLPPPSLPPPSRRSRPSRKEKEPVKAKPEPKPKPSKQPMSRIKRNNGPKSSPATSSSVSIPCWGVDFPRTGFTPSGPTLTSGSLKGHLSKAACRSTPPAGTSHAEWAKKFRSAESVLMKQLKQIHGSKAGKAKLDDMRDQGWVHDRAVYMLEKEKEKKAAKEAANTAAEEEKDEDGDVEMTGFAANTAAEEEMDEDEDEDEKMEGVWGSAEDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.45
3 0.39
4 0.35
5 0.36
6 0.34
7 0.28
8 0.28
9 0.23
10 0.2
11 0.19
12 0.17
13 0.17
14 0.19
15 0.24
16 0.24
17 0.27
18 0.31
19 0.33
20 0.4
21 0.42
22 0.44
23 0.42
24 0.46
25 0.47
26 0.46
27 0.45
28 0.41
29 0.44
30 0.42
31 0.39
32 0.37
33 0.35
34 0.36
35 0.38
36 0.36
37 0.3
38 0.34
39 0.33
40 0.33
41 0.31
42 0.28
43 0.24
44 0.23
45 0.23
46 0.18
47 0.21
48 0.23
49 0.22
50 0.21
51 0.2
52 0.24
53 0.25
54 0.24
55 0.21
56 0.22
57 0.28
58 0.3
59 0.3
60 0.26
61 0.26
62 0.27
63 0.28
64 0.23
65 0.17
66 0.15
67 0.16
68 0.14
69 0.11
70 0.11
71 0.08
72 0.09
73 0.09
74 0.1
75 0.09
76 0.1
77 0.1
78 0.11
79 0.14
80 0.13
81 0.13
82 0.13
83 0.2
84 0.25
85 0.31
86 0.32
87 0.36
88 0.42
89 0.5
90 0.56
91 0.57
92 0.6
93 0.64
94 0.72
95 0.77
96 0.8
97 0.81
98 0.84
99 0.84
100 0.85
101 0.84
102 0.81
103 0.78
104 0.75
105 0.72
106 0.72
107 0.75
108 0.73
109 0.72
110 0.75
111 0.72
112 0.75
113 0.78
114 0.8
115 0.76
116 0.79
117 0.8
118 0.79
119 0.83
120 0.8
121 0.77
122 0.74
123 0.77
124 0.76
125 0.71
126 0.65
127 0.6
128 0.58
129 0.55
130 0.48
131 0.4
132 0.35
133 0.3
134 0.27
135 0.25
136 0.19
137 0.17
138 0.16
139 0.14
140 0.1
141 0.11
142 0.09
143 0.08
144 0.08
145 0.09
146 0.09
147 0.11
148 0.12
149 0.12
150 0.13
151 0.13
152 0.15
153 0.15
154 0.16
155 0.13
156 0.14
157 0.14
158 0.15
159 0.15
160 0.12
161 0.12
162 0.13
163 0.13
164 0.14
165 0.13
166 0.15
167 0.15
168 0.17
169 0.23
170 0.24
171 0.24
172 0.23
173 0.26
174 0.28
175 0.29
176 0.26
177 0.22
178 0.22
179 0.23
180 0.23
181 0.27
182 0.28
183 0.27
184 0.26
185 0.3
186 0.29
187 0.32
188 0.31
189 0.24
190 0.26
191 0.27
192 0.33
193 0.35
194 0.36
195 0.36
196 0.39
197 0.38
198 0.35
199 0.38
200 0.33
201 0.32
202 0.32
203 0.32
204 0.38
205 0.4
206 0.42
207 0.43
208 0.44
209 0.41
210 0.38
211 0.4
212 0.36
213 0.39
214 0.38
215 0.34
216 0.33
217 0.33
218 0.32
219 0.28
220 0.29
221 0.26
222 0.23
223 0.22
224 0.21
225 0.19
226 0.21
227 0.2
228 0.16
229 0.2
230 0.23
231 0.26
232 0.29
233 0.32
234 0.39
235 0.43
236 0.45
237 0.46
238 0.52
239 0.51
240 0.55
241 0.55
242 0.54
243 0.51
244 0.46
245 0.41
246 0.34
247 0.3
248 0.24
249 0.22
250 0.16
251 0.14
252 0.14
253 0.13
254 0.11
255 0.11
256 0.1
257 0.08
258 0.07
259 0.07
260 0.06
261 0.06
262 0.05
263 0.04
264 0.04
265 0.04
266 0.05
267 0.05
268 0.05
269 0.06
270 0.07
271 0.08
272 0.1
273 0.09
274 0.09
275 0.1
276 0.1
277 0.1
278 0.1
279 0.09
280 0.07
281 0.07
282 0.08
283 0.07
284 0.07
285 0.08
286 0.07