Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6PPE3

Protein Details
Accession A0A2J6PPE3   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-47LFNPPKGKVLRKRSHSAQTSAPSRRPTKKSKPSPRPPASPTTFHydrophilic
NLS Segment(s)
PositionSequence
10-40KGKVLRKRSHSAQTSAPSRRPTKKSKPSPRP
125-141KPVRRKSVIRRVLDKRR
Subcellular Location(s) nucl 13, mito 12, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MLFSLFNPPKGKVLRKRSHSAQTSAPSRRPTKKSKPSPRPPASPTTFTQPLSPQPPEIILSSHPDPDTISTPPPSIKSSRSRPTRSTSLKKRNSHAPSTVPPLPESTTTHPYAENGAGNEKEGVKPVRRKSVIRRVLDKRRERIEAGNNYYSTYGGPWTNGEEKQEYDPKLGIENLPLRQYSGLHIGSPSQLLAEDGGKQEEGAGGRSELGAEEIGIALSGDEQEESGEKGKEKGKGTVGGEAKTRRGGYWGDFPSHSYGGLYGGLSGVGYVYGGHRGGQTSHEGDRGHHEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.71
3 0.78
4 0.79
5 0.82
6 0.78
7 0.72
8 0.69
9 0.68
10 0.69
11 0.67
12 0.65
13 0.63
14 0.65
15 0.7
16 0.7
17 0.71
18 0.74
19 0.78
20 0.84
21 0.87
22 0.9
23 0.91
24 0.95
25 0.93
26 0.9
27 0.84
28 0.83
29 0.78
30 0.71
31 0.62
32 0.59
33 0.55
34 0.47
35 0.45
36 0.38
37 0.39
38 0.4
39 0.4
40 0.32
41 0.29
42 0.3
43 0.28
44 0.26
45 0.21
46 0.16
47 0.2
48 0.2
49 0.22
50 0.21
51 0.19
52 0.19
53 0.2
54 0.21
55 0.18
56 0.19
57 0.17
58 0.19
59 0.2
60 0.22
61 0.23
62 0.23
63 0.27
64 0.33
65 0.4
66 0.49
67 0.56
68 0.6
69 0.61
70 0.66
71 0.69
72 0.7
73 0.72
74 0.73
75 0.75
76 0.78
77 0.79
78 0.77
79 0.77
80 0.74
81 0.69
82 0.62
83 0.57
84 0.51
85 0.52
86 0.51
87 0.42
88 0.36
89 0.32
90 0.29
91 0.26
92 0.26
93 0.24
94 0.25
95 0.26
96 0.26
97 0.24
98 0.23
99 0.23
100 0.21
101 0.17
102 0.13
103 0.14
104 0.13
105 0.13
106 0.14
107 0.12
108 0.11
109 0.13
110 0.15
111 0.18
112 0.26
113 0.29
114 0.38
115 0.4
116 0.44
117 0.5
118 0.59
119 0.61
120 0.58
121 0.63
122 0.62
123 0.69
124 0.75
125 0.72
126 0.67
127 0.63
128 0.61
129 0.55
130 0.52
131 0.51
132 0.48
133 0.47
134 0.43
135 0.39
136 0.37
137 0.35
138 0.29
139 0.2
140 0.13
141 0.1
142 0.07
143 0.07
144 0.07
145 0.1
146 0.13
147 0.13
148 0.15
149 0.14
150 0.15
151 0.19
152 0.24
153 0.22
154 0.2
155 0.21
156 0.19
157 0.19
158 0.19
159 0.15
160 0.14
161 0.17
162 0.17
163 0.18
164 0.18
165 0.17
166 0.16
167 0.17
168 0.14
169 0.16
170 0.15
171 0.14
172 0.14
173 0.14
174 0.14
175 0.14
176 0.12
177 0.06
178 0.06
179 0.06
180 0.06
181 0.06
182 0.07
183 0.08
184 0.09
185 0.08
186 0.08
187 0.08
188 0.09
189 0.09
190 0.09
191 0.09
192 0.08
193 0.09
194 0.09
195 0.09
196 0.07
197 0.07
198 0.05
199 0.05
200 0.05
201 0.04
202 0.04
203 0.04
204 0.04
205 0.03
206 0.03
207 0.03
208 0.03
209 0.03
210 0.04
211 0.04
212 0.05
213 0.07
214 0.09
215 0.11
216 0.12
217 0.16
218 0.2
219 0.27
220 0.28
221 0.32
222 0.34
223 0.39
224 0.39
225 0.43
226 0.42
227 0.37
228 0.41
229 0.38
230 0.36
231 0.34
232 0.33
233 0.26
234 0.26
235 0.26
236 0.25
237 0.32
238 0.33
239 0.32
240 0.32
241 0.34
242 0.36
243 0.33
244 0.29
245 0.2
246 0.17
247 0.15
248 0.15
249 0.13
250 0.08
251 0.08
252 0.07
253 0.07
254 0.06
255 0.05
256 0.03
257 0.04
258 0.04
259 0.05
260 0.08
261 0.08
262 0.1
263 0.11
264 0.13
265 0.14
266 0.16
267 0.21
268 0.22
269 0.24
270 0.28
271 0.27
272 0.27