Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6PPS4

Protein Details
Accession A0A2J6PPS4    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
251-270RCTNCPRDPAKKKKYPDGYPHydrophilic
NLS Segment(s)
PositionSequence
174-174P
176-179GKGK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MSTSARSGPAEKKENGVDKLLRRMKTVFNKSDGSKRLSFPGRSKSVSGPRYVLRPLRVSANTSSKPDPEPAAATTTAPVAAAPETKVPEGAVKVMRSEIEAERNKKLAERFAITIEPLTTSKPDKETYRIEKPVRMRIHRICHKCNTTYGGSKTCVECGHPRCTKCPRYPAKKPDGKGKSKEAAVPKGDVIEADTWYGLKEEIPLTMPNPKPGGQPLVLKAPRQRVRRTCCKCETMYMTGSKTCASCHHSRCTNCPRDPAKKKKYPDGYPGDAYSDDITKPIKYACHRCGQVYPPVPHPDSEEGKAAADAAPPECVRCQHPKCEVCPRAAPAKVEPAPDPDVVRSVQAKLAALNISHSATEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.54
3 0.53
4 0.51
5 0.48
6 0.58
7 0.6
8 0.54
9 0.5
10 0.51
11 0.53
12 0.58
13 0.63
14 0.58
15 0.56
16 0.6
17 0.6
18 0.66
19 0.62
20 0.57
21 0.52
22 0.48
23 0.51
24 0.54
25 0.56
26 0.54
27 0.58
28 0.58
29 0.56
30 0.57
31 0.57
32 0.59
33 0.57
34 0.53
35 0.48
36 0.44
37 0.45
38 0.48
39 0.45
40 0.4
41 0.4
42 0.38
43 0.42
44 0.41
45 0.4
46 0.41
47 0.45
48 0.43
49 0.44
50 0.45
51 0.39
52 0.4
53 0.38
54 0.35
55 0.28
56 0.27
57 0.24
58 0.25
59 0.23
60 0.21
61 0.18
62 0.16
63 0.14
64 0.11
65 0.09
66 0.07
67 0.07
68 0.08
69 0.09
70 0.11
71 0.13
72 0.13
73 0.14
74 0.13
75 0.15
76 0.14
77 0.17
78 0.18
79 0.17
80 0.17
81 0.18
82 0.18
83 0.16
84 0.19
85 0.17
86 0.23
87 0.29
88 0.32
89 0.34
90 0.36
91 0.35
92 0.36
93 0.36
94 0.32
95 0.3
96 0.3
97 0.28
98 0.29
99 0.29
100 0.26
101 0.24
102 0.18
103 0.15
104 0.12
105 0.12
106 0.12
107 0.13
108 0.15
109 0.18
110 0.21
111 0.22
112 0.27
113 0.34
114 0.4
115 0.46
116 0.52
117 0.51
118 0.53
119 0.55
120 0.59
121 0.58
122 0.55
123 0.54
124 0.53
125 0.61
126 0.65
127 0.67
128 0.64
129 0.65
130 0.65
131 0.59
132 0.54
133 0.49
134 0.43
135 0.42
136 0.39
137 0.35
138 0.32
139 0.32
140 0.3
141 0.27
142 0.23
143 0.2
144 0.24
145 0.25
146 0.32
147 0.35
148 0.36
149 0.41
150 0.49
151 0.54
152 0.52
153 0.58
154 0.59
155 0.64
156 0.73
157 0.76
158 0.77
159 0.75
160 0.72
161 0.72
162 0.71
163 0.68
164 0.63
165 0.6
166 0.53
167 0.49
168 0.51
169 0.46
170 0.42
171 0.36
172 0.33
173 0.27
174 0.23
175 0.22
176 0.17
177 0.14
178 0.09
179 0.08
180 0.07
181 0.07
182 0.06
183 0.07
184 0.07
185 0.05
186 0.04
187 0.06
188 0.06
189 0.06
190 0.08
191 0.08
192 0.09
193 0.17
194 0.17
195 0.18
196 0.2
197 0.21
198 0.2
199 0.22
200 0.25
201 0.19
202 0.21
203 0.21
204 0.29
205 0.29
206 0.3
207 0.32
208 0.39
209 0.44
210 0.47
211 0.54
212 0.54
213 0.61
214 0.7
215 0.74
216 0.73
217 0.71
218 0.71
219 0.63
220 0.6
221 0.57
222 0.5
223 0.46
224 0.4
225 0.35
226 0.31
227 0.3
228 0.25
229 0.19
230 0.16
231 0.17
232 0.2
233 0.27
234 0.31
235 0.38
236 0.44
237 0.46
238 0.55
239 0.61
240 0.64
241 0.59
242 0.63
243 0.64
244 0.68
245 0.76
246 0.78
247 0.78
248 0.77
249 0.79
250 0.8
251 0.82
252 0.77
253 0.77
254 0.74
255 0.69
256 0.63
257 0.59
258 0.51
259 0.41
260 0.35
261 0.27
262 0.2
263 0.14
264 0.13
265 0.14
266 0.11
267 0.13
268 0.13
269 0.18
270 0.24
271 0.33
272 0.37
273 0.45
274 0.46
275 0.48
276 0.52
277 0.5
278 0.52
279 0.52
280 0.49
281 0.47
282 0.52
283 0.5
284 0.45
285 0.45
286 0.43
287 0.39
288 0.38
289 0.35
290 0.29
291 0.28
292 0.28
293 0.23
294 0.17
295 0.15
296 0.14
297 0.11
298 0.14
299 0.14
300 0.16
301 0.17
302 0.18
303 0.22
304 0.31
305 0.35
306 0.4
307 0.5
308 0.55
309 0.6
310 0.69
311 0.67
312 0.62
313 0.63
314 0.59
315 0.58
316 0.56
317 0.52
318 0.45
319 0.52
320 0.49
321 0.46
322 0.43
323 0.4
324 0.4
325 0.38
326 0.37
327 0.28
328 0.28
329 0.25
330 0.27
331 0.24
332 0.22
333 0.23
334 0.23
335 0.22
336 0.2
337 0.23
338 0.21
339 0.19
340 0.2
341 0.19
342 0.18