Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6PRT4

Protein Details
Accession A0A2J6PRT4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
48-72FITFLCCKCRRHKKKLREQGESANDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 6cyto 6cyto_mito 6, plas 5, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPALPLPLQLFKRACEASDGYVCYHMPIPAVIGIVFGCAFLLITGIFITFLCCKCRRHKKKLREQGESANDDSILAYNGAKRGETIDFNPHAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.28
4 0.28
5 0.25
6 0.28
7 0.28
8 0.22
9 0.23
10 0.23
11 0.19
12 0.19
13 0.14
14 0.11
15 0.1
16 0.1
17 0.09
18 0.09
19 0.08
20 0.07
21 0.06
22 0.06
23 0.06
24 0.05
25 0.04
26 0.03
27 0.03
28 0.03
29 0.03
30 0.02
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.05
37 0.07
38 0.08
39 0.12
40 0.15
41 0.19
42 0.29
43 0.41
44 0.49
45 0.59
46 0.68
47 0.75
48 0.84
49 0.91
50 0.91
51 0.87
52 0.82
53 0.8
54 0.77
55 0.7
56 0.59
57 0.49
58 0.39
59 0.31
60 0.27
61 0.18
62 0.11
63 0.08
64 0.07
65 0.09
66 0.11
67 0.12
68 0.12
69 0.12
70 0.14
71 0.17
72 0.2
73 0.21
74 0.28