Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6QAM0

Protein Details
Accession A0A2J6QAM0   
Localization Confidence High
Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
23-51DAPAPSKKSQQPANTKKKRKAENEVPEEEHydrophilic
241-265EHFREWEKKGFKKARRGEYENPSAAHydrophilic
NLS Segment(s)
PositionSequence
36-42NTKKKRK
102-118KPNIKPFKGPPGKKVRK
248-272KKGFKKARRGEYENPSAAEKKRMGR
Subcellular Location(s) nucl 19.5, mito_nucl 13.833, cyto_nucl 11.166, mito 6
Family & Domain DBs
Amino Acid Sequences MVSTRSGTTLKASNRGINKNAADAPAPSKKSQQPANTKKKRKAENEVPEEENNENLGRPSTPPAASKVSTTPHNDSELAHLPSYERTPGRVGPIKEEKFDVKPNIKPFKGPPGKKVRKTAWEKEEEYKQFALENEDHVFHELHVCFHKGPNGTPTYDKSGFQLDYKKVANWMEPKPYNKGAMMRGMDRAIDKAQSEAELMAEIFFEKGEAPEDLEWSNGNNYWKDRVSKDLNVPWHKIGVEHFREWEKKGFKKARRGEYENPSAAEKKRMGRLMSGASLRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.52
4 0.53
5 0.5
6 0.47
7 0.46
8 0.41
9 0.34
10 0.3
11 0.33
12 0.34
13 0.36
14 0.33
15 0.38
16 0.42
17 0.48
18 0.54
19 0.57
20 0.6
21 0.67
22 0.77
23 0.81
24 0.85
25 0.87
26 0.88
27 0.88
28 0.86
29 0.86
30 0.85
31 0.85
32 0.84
33 0.8
34 0.75
35 0.66
36 0.6
37 0.5
38 0.4
39 0.3
40 0.22
41 0.17
42 0.13
43 0.13
44 0.11
45 0.12
46 0.16
47 0.19
48 0.2
49 0.21
50 0.25
51 0.29
52 0.28
53 0.29
54 0.28
55 0.27
56 0.3
57 0.34
58 0.35
59 0.32
60 0.34
61 0.33
62 0.29
63 0.32
64 0.33
65 0.29
66 0.25
67 0.22
68 0.2
69 0.21
70 0.22
71 0.21
72 0.15
73 0.15
74 0.18
75 0.19
76 0.26
77 0.3
78 0.29
79 0.32
80 0.42
81 0.42
82 0.4
83 0.41
84 0.37
85 0.34
86 0.39
87 0.38
88 0.33
89 0.37
90 0.44
91 0.5
92 0.47
93 0.46
94 0.43
95 0.48
96 0.53
97 0.5
98 0.5
99 0.53
100 0.62
101 0.66
102 0.71
103 0.66
104 0.66
105 0.72
106 0.72
107 0.69
108 0.66
109 0.63
110 0.6
111 0.62
112 0.54
113 0.49
114 0.4
115 0.32
116 0.26
117 0.24
118 0.23
119 0.15
120 0.16
121 0.14
122 0.14
123 0.14
124 0.14
125 0.14
126 0.1
127 0.13
128 0.11
129 0.11
130 0.12
131 0.13
132 0.12
133 0.12
134 0.16
135 0.13
136 0.14
137 0.18
138 0.19
139 0.19
140 0.21
141 0.22
142 0.26
143 0.26
144 0.26
145 0.22
146 0.23
147 0.23
148 0.23
149 0.27
150 0.21
151 0.24
152 0.25
153 0.24
154 0.23
155 0.23
156 0.26
157 0.25
158 0.27
159 0.32
160 0.35
161 0.37
162 0.39
163 0.41
164 0.38
165 0.34
166 0.34
167 0.28
168 0.3
169 0.3
170 0.26
171 0.25
172 0.24
173 0.23
174 0.19
175 0.19
176 0.14
177 0.13
178 0.12
179 0.11
180 0.11
181 0.11
182 0.11
183 0.09
184 0.08
185 0.07
186 0.07
187 0.06
188 0.05
189 0.05
190 0.04
191 0.04
192 0.04
193 0.04
194 0.05
195 0.06
196 0.07
197 0.09
198 0.09
199 0.11
200 0.11
201 0.11
202 0.11
203 0.11
204 0.12
205 0.13
206 0.15
207 0.16
208 0.18
209 0.23
210 0.26
211 0.29
212 0.3
213 0.34
214 0.38
215 0.42
216 0.48
217 0.49
218 0.55
219 0.56
220 0.58
221 0.52
222 0.48
223 0.42
224 0.35
225 0.35
226 0.35
227 0.35
228 0.33
229 0.36
230 0.39
231 0.43
232 0.45
233 0.48
234 0.46
235 0.47
236 0.56
237 0.63
238 0.64
239 0.72
240 0.78
241 0.8
242 0.81
243 0.83
244 0.81
245 0.81
246 0.82
247 0.74
248 0.66
249 0.6
250 0.55
251 0.5
252 0.48
253 0.43
254 0.41
255 0.45
256 0.5
257 0.48
258 0.47
259 0.5
260 0.48
261 0.5