Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6PL09

Protein Details
Accession A0A2J6PL09    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-66KISPKHQFRLERKYKRRAKLKWARPRWTKAVKIBasic
NLS Segment(s)
PositionSequence
41-62FRLERKYKRRAKLKWARPRWTK
Subcellular Location(s) mito 12.5, mito_nucl 11.833, nucl 10, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MFSTLVRRTAQEKLPFIYTNPYKAQRLWPPDFTKISPKHQFRLERKYKRRAKLKWARPRWTKAVKIVQMGSILCG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.39
4 0.42
5 0.36
6 0.33
7 0.35
8 0.37
9 0.34
10 0.35
11 0.42
12 0.4
13 0.46
14 0.46
15 0.47
16 0.47
17 0.5
18 0.51
19 0.45
20 0.47
21 0.42
22 0.46
23 0.48
24 0.46
25 0.45
26 0.49
27 0.57
28 0.54
29 0.61
30 0.64
31 0.66
32 0.72
33 0.79
34 0.81
35 0.81
36 0.85
37 0.81
38 0.81
39 0.81
40 0.84
41 0.84
42 0.86
43 0.86
44 0.85
45 0.86
46 0.84
47 0.82
48 0.78
49 0.76
50 0.76
51 0.7
52 0.67
53 0.61
54 0.54
55 0.48