Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6Q0T2

Protein Details
Accession A0A2J6Q0T2   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAVKPPKRRSERLSRRKSTLIHydrophilic
NLS Segment(s)
PositionSequence
5-17PPKRRSERLSRRK
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MAVKPPKRRSERLSRRKSTLINKAHELAEFCDVNVALIIRNRQTGRYFTYNSVDLESWPPSKEQIQLLYPVPVNLLPHDMEASRGNLKYCSRSELVEQKVRAEEGLVDRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.79
4 0.78
5 0.76
6 0.75
7 0.72
8 0.66
9 0.63
10 0.59
11 0.53
12 0.47
13 0.39
14 0.31
15 0.27
16 0.21
17 0.17
18 0.16
19 0.15
20 0.13
21 0.12
22 0.1
23 0.07
24 0.09
25 0.11
26 0.1
27 0.14
28 0.15
29 0.17
30 0.19
31 0.21
32 0.24
33 0.28
34 0.29
35 0.27
36 0.29
37 0.28
38 0.27
39 0.26
40 0.2
41 0.16
42 0.15
43 0.15
44 0.14
45 0.12
46 0.12
47 0.12
48 0.13
49 0.15
50 0.15
51 0.16
52 0.16
53 0.19
54 0.19
55 0.2
56 0.19
57 0.16
58 0.15
59 0.12
60 0.12
61 0.1
62 0.11
63 0.09
64 0.1
65 0.11
66 0.1
67 0.12
68 0.12
69 0.15
70 0.16
71 0.17
72 0.17
73 0.21
74 0.23
75 0.26
76 0.27
77 0.29
78 0.27
79 0.28
80 0.34
81 0.39
82 0.44
83 0.46
84 0.45
85 0.43
86 0.44
87 0.42
88 0.36
89 0.28
90 0.24