Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6PI66

Protein Details
Accession A0A2J6PI66    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-57MPPKVPTIKDEKRAERKERKREKKRKAKEEKAAAAPAPAEKKRKKNPPKLLRRDWAABasic
NLS Segment(s)
PositionSequence
10-53DEKRAERKERKREKKRKAKEEKAAAAPAPAEKKRKKNPPKLLRR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPPKVPTIKDEKRAERKERKREKKRKAKEEKAAAAPAPAEKKRKKNPPKLLRRDWAAMKASLVYDERGFGRTPDGAWAYFLAVRPASEKALPAGHAAERS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.86
4 0.88
5 0.9
6 0.91
7 0.92
8 0.94
9 0.95
10 0.95
11 0.95
12 0.95
13 0.95
14 0.94
15 0.93
16 0.91
17 0.87
18 0.8
19 0.72
20 0.6
21 0.5
22 0.4
23 0.32
24 0.28
25 0.25
26 0.28
27 0.32
28 0.41
29 0.5
30 0.6
31 0.68
32 0.73
33 0.81
34 0.83
35 0.88
36 0.89
37 0.87
38 0.81
39 0.75
40 0.68
41 0.59
42 0.53
43 0.44
44 0.35
45 0.27
46 0.23
47 0.19
48 0.17
49 0.15
50 0.11
51 0.09
52 0.1
53 0.1
54 0.11
55 0.12
56 0.1
57 0.12
58 0.11
59 0.11
60 0.14
61 0.15
62 0.14
63 0.15
64 0.15
65 0.14
66 0.15
67 0.15
68 0.14
69 0.12
70 0.13
71 0.14
72 0.16
73 0.17
74 0.16
75 0.16
76 0.16
77 0.19
78 0.19
79 0.19
80 0.19