Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6QK56

Protein Details
Accession A0A2J6QK56    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-36KPETVAKTLRKLRRHPNQPRTHYEFFPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR004640  HscB  
IPR036386  HscB_C_sf  
IPR009073  HscB_oligo_C  
IPR036869  J_dom_sf  
Gene Ontology GO:0001671  F:ATPase activator activity  
GO:0051087  F:protein-folding chaperone binding  
GO:0044571  P:[2Fe-2S] cluster assembly  
GO:0051259  P:protein complex oligomerization  
Pfam View protein in Pfam  
PF00226  DnaJ  
PF07743  HSCB_C  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MQQEARPTYKPETVAKTLRKLRRHPNQPRTHYEFFPKTLTQGPPPTGSFHIDTRELRREFLQLQAVAHPDRHPHNLKTRAEATSARINEAYKTLQNPLLRAQYLLSLRGIDVAEDETAKVEDPELLMEVLDAREEIEDAKEEEELEEMKRINEERIEKSESILDEAFNRDDIDGAKAEAVRLRYWVNIKESLDAWEQGKPVVLVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.61
4 0.65
5 0.69
6 0.71
7 0.72
8 0.76
9 0.78
10 0.83
11 0.84
12 0.86
13 0.88
14 0.88
15 0.89
16 0.87
17 0.81
18 0.73
19 0.71
20 0.65
21 0.57
22 0.54
23 0.45
24 0.38
25 0.4
26 0.39
27 0.36
28 0.37
29 0.36
30 0.35
31 0.35
32 0.36
33 0.32
34 0.32
35 0.28
36 0.25
37 0.26
38 0.26
39 0.28
40 0.3
41 0.37
42 0.35
43 0.34
44 0.33
45 0.33
46 0.3
47 0.32
48 0.31
49 0.23
50 0.23
51 0.23
52 0.24
53 0.21
54 0.21
55 0.18
56 0.16
57 0.19
58 0.25
59 0.28
60 0.29
61 0.38
62 0.46
63 0.46
64 0.48
65 0.48
66 0.42
67 0.4
68 0.38
69 0.32
70 0.3
71 0.29
72 0.25
73 0.23
74 0.22
75 0.2
76 0.2
77 0.18
78 0.12
79 0.13
80 0.14
81 0.17
82 0.18
83 0.18
84 0.19
85 0.2
86 0.19
87 0.18
88 0.16
89 0.16
90 0.16
91 0.16
92 0.13
93 0.1
94 0.1
95 0.11
96 0.11
97 0.07
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.05
104 0.05
105 0.05
106 0.05
107 0.04
108 0.04
109 0.04
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.04
118 0.04
119 0.03
120 0.04
121 0.04
122 0.04
123 0.05
124 0.06
125 0.07
126 0.07
127 0.07
128 0.07
129 0.07
130 0.08
131 0.08
132 0.08
133 0.1
134 0.1
135 0.1
136 0.12
137 0.13
138 0.14
139 0.19
140 0.23
141 0.25
142 0.3
143 0.34
144 0.32
145 0.33
146 0.34
147 0.29
148 0.28
149 0.23
150 0.19
151 0.16
152 0.18
153 0.18
154 0.15
155 0.15
156 0.11
157 0.12
158 0.12
159 0.13
160 0.11
161 0.11
162 0.12
163 0.12
164 0.13
165 0.15
166 0.16
167 0.14
168 0.16
169 0.17
170 0.2
171 0.25
172 0.29
173 0.31
174 0.35
175 0.36
176 0.36
177 0.35
178 0.35
179 0.33
180 0.3
181 0.27
182 0.24
183 0.23
184 0.21
185 0.22