Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6QI28

Protein Details
Accession A0A2J6QI28    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
32-51HMQQKTRKPWRPMCNRNEPVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8, cyto 4
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MINSPSRDHRPSQILANSNIGIIAGSCSRPAHMQQKTRKPWRPMCNRNEPVETRNSFPLLTPAHGAEVETGAIAIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.44
3 0.44
4 0.37
5 0.31
6 0.28
7 0.2
8 0.14
9 0.09
10 0.09
11 0.06
12 0.06
13 0.07
14 0.07
15 0.08
16 0.1
17 0.14
18 0.21
19 0.27
20 0.35
21 0.43
22 0.53
23 0.62
24 0.7
25 0.74
26 0.73
27 0.76
28 0.78
29 0.8
30 0.8
31 0.79
32 0.8
33 0.77
34 0.74
35 0.7
36 0.62
37 0.54
38 0.53
39 0.47
40 0.38
41 0.36
42 0.33
43 0.27
44 0.25
45 0.28
46 0.22
47 0.21
48 0.2
49 0.18
50 0.19
51 0.19
52 0.19
53 0.14
54 0.12
55 0.11
56 0.09