Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6PUQ8

Protein Details
Accession A0A2J6PUQ8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
85-104SAPKTPKTPKTKTPKDKTKVHydrophilic
117-136KGSPTPKKLGRKPKVVKEEEBasic
NLS Segment(s)
PositionSequence
93-101PKTKTPKDK
114-130KVSKGSPTPKKLGRKPK
Subcellular Location(s) cyto 11, mito 10, cyto_nucl 8.5, nucl 4
Family & Domain DBs
Amino Acid Sequences MSQEGENAAVPTTPSKDAGAPTPKEAGFILAILNNMKNKPEVDWDVVAQKSGFSNGKTAATRFGQIKKKWGAMNSDIDTTASTTSAPKTPKTPKTKTPKDKTKVGSGTNTTASKVSKGSPTPKKLGRKPKVVKEEEPEEPEENGHEDLEMDETLAVVGEEIEYYEAEEDSIAVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.18
4 0.2
5 0.27
6 0.33
7 0.32
8 0.33
9 0.36
10 0.35
11 0.34
12 0.32
13 0.26
14 0.18
15 0.16
16 0.14
17 0.1
18 0.11
19 0.11
20 0.13
21 0.14
22 0.14
23 0.15
24 0.16
25 0.15
26 0.17
27 0.22
28 0.24
29 0.25
30 0.26
31 0.26
32 0.29
33 0.28
34 0.27
35 0.2
36 0.17
37 0.13
38 0.15
39 0.16
40 0.12
41 0.14
42 0.15
43 0.19
44 0.19
45 0.19
46 0.2
47 0.19
48 0.21
49 0.22
50 0.29
51 0.33
52 0.34
53 0.41
54 0.4
55 0.44
56 0.43
57 0.42
58 0.4
59 0.35
60 0.4
61 0.34
62 0.31
63 0.26
64 0.24
65 0.22
66 0.17
67 0.13
68 0.07
69 0.06
70 0.06
71 0.07
72 0.11
73 0.12
74 0.12
75 0.19
76 0.27
77 0.35
78 0.44
79 0.47
80 0.52
81 0.62
82 0.72
83 0.76
84 0.78
85 0.8
86 0.77
87 0.8
88 0.74
89 0.72
90 0.67
91 0.59
92 0.54
93 0.46
94 0.43
95 0.39
96 0.36
97 0.28
98 0.24
99 0.22
100 0.18
101 0.17
102 0.16
103 0.17
104 0.21
105 0.3
106 0.37
107 0.42
108 0.47
109 0.54
110 0.61
111 0.65
112 0.73
113 0.71
114 0.73
115 0.76
116 0.8
117 0.83
118 0.79
119 0.75
120 0.71
121 0.68
122 0.62
123 0.58
124 0.51
125 0.43
126 0.37
127 0.32
128 0.27
129 0.23
130 0.19
131 0.15
132 0.11
133 0.09
134 0.09
135 0.11
136 0.1
137 0.08
138 0.07
139 0.07
140 0.06
141 0.06
142 0.05
143 0.03
144 0.03
145 0.03
146 0.03
147 0.04
148 0.05
149 0.05
150 0.06
151 0.07
152 0.06
153 0.06
154 0.06
155 0.06