Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6PVN9

Protein Details
Accession A0A2J6PVN9    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
13-39LGNYICSSCTHRLRRHRRSYATISSSGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 5, nucl 4, plas 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002938  FAD-bd  
IPR036188  FAD/NAD-bd_sf  
IPR018168  Ubi_Hdrlase_CS  
IPR010971  UbiH/COQ6  
IPR000689  UbQ_mOase_COQ6  
Gene Ontology GO:0031314  C:extrinsic component of mitochondrial inner membrane  
GO:0008681  F:2-octaprenyl-6-methoxyphenol hydroxylase activity  
GO:0106364  F:4-hydroxy-3-all-trans-hexaprenylbenzoate oxygenase activity  
GO:0071949  F:FAD binding  
GO:0016709  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen  
GO:0006744  P:ubiquinone biosynthetic process  
Pfam View protein in Pfam  
PF01494  FAD_binding_3  
PROSITE View protein in PROSITE  
PS01304  UBIH  
Amino Acid Sequences MKPSPAAVQPRQLGNYICSSCTHRLRRHRRSYATISSSGKPSIYDVVCVGGGPAGLSLLAALRSSPATANLKVALVESQDLSKTRDLSLPPNRFSNRCSSLTPSSVRFLDGIGAWKHVKRERVQGYTEMQVWDGVSGARIEFDWNAEQAAGGEGRPIAFMNENPNLTSGLLKRIDALGGVEIMDGERVENIGFGEESEEVDLSMWPVVELSGGKRLAARLLVGADGANSPVRAFAGIESRGWDYERHGVVATLEMKGSGWGGEEFKTAYQRFLPTGPVAMLPLPGNYSTLVWSTTPALAAHLKTLSPMDFIAMVNAAFRLSPVDLAYMHTQASGQADEFSWRAQHTEFDMQRVPQQVVGVQEGSVASFPLKLRHADTYIGERVALVGDAAHTIHPLAGQGLNQGQGDVESLIKTINYAVTHGQDIGVQMSLEQYNAERYAANNMLLGVCDKLHKLYAIESGPLVGLRSIGLRAVNSLGPLKRFMVSQASDGVKIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.36
4 0.32
5 0.3
6 0.34
7 0.39
8 0.46
9 0.53
10 0.54
11 0.63
12 0.73
13 0.82
14 0.87
15 0.89
16 0.88
17 0.87
18 0.87
19 0.86
20 0.81
21 0.77
22 0.7
23 0.63
24 0.58
25 0.5
26 0.42
27 0.32
28 0.28
29 0.29
30 0.25
31 0.23
32 0.2
33 0.2
34 0.2
35 0.19
36 0.17
37 0.1
38 0.09
39 0.07
40 0.07
41 0.05
42 0.04
43 0.04
44 0.04
45 0.04
46 0.05
47 0.05
48 0.05
49 0.06
50 0.07
51 0.08
52 0.09
53 0.14
54 0.18
55 0.19
56 0.21
57 0.21
58 0.21
59 0.21
60 0.21
61 0.16
62 0.13
63 0.13
64 0.11
65 0.12
66 0.13
67 0.15
68 0.17
69 0.19
70 0.19
71 0.2
72 0.23
73 0.24
74 0.32
75 0.41
76 0.45
77 0.45
78 0.52
79 0.54
80 0.51
81 0.52
82 0.52
83 0.47
84 0.43
85 0.43
86 0.42
87 0.43
88 0.47
89 0.47
90 0.4
91 0.38
92 0.35
93 0.33
94 0.26
95 0.21
96 0.18
97 0.16
98 0.18
99 0.15
100 0.18
101 0.19
102 0.21
103 0.26
104 0.28
105 0.34
106 0.32
107 0.42
108 0.46
109 0.5
110 0.51
111 0.5
112 0.49
113 0.46
114 0.44
115 0.34
116 0.27
117 0.22
118 0.19
119 0.14
120 0.11
121 0.08
122 0.06
123 0.06
124 0.06
125 0.05
126 0.05
127 0.07
128 0.07
129 0.09
130 0.1
131 0.1
132 0.1
133 0.1
134 0.09
135 0.08
136 0.09
137 0.07
138 0.06
139 0.06
140 0.06
141 0.06
142 0.07
143 0.06
144 0.06
145 0.07
146 0.08
147 0.14
148 0.17
149 0.17
150 0.17
151 0.18
152 0.18
153 0.17
154 0.18
155 0.14
156 0.16
157 0.17
158 0.16
159 0.16
160 0.16
161 0.16
162 0.13
163 0.13
164 0.07
165 0.06
166 0.06
167 0.05
168 0.05
169 0.05
170 0.05
171 0.04
172 0.03
173 0.03
174 0.03
175 0.03
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.06
182 0.06
183 0.06
184 0.06
185 0.06
186 0.05
187 0.06
188 0.06
189 0.05
190 0.05
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.05
197 0.05
198 0.1
199 0.1
200 0.1
201 0.11
202 0.11
203 0.12
204 0.12
205 0.11
206 0.07
207 0.07
208 0.07
209 0.06
210 0.06
211 0.06
212 0.05
213 0.06
214 0.05
215 0.05
216 0.04
217 0.04
218 0.05
219 0.04
220 0.04
221 0.05
222 0.09
223 0.1
224 0.1
225 0.12
226 0.12
227 0.12
228 0.13
229 0.12
230 0.1
231 0.16
232 0.16
233 0.15
234 0.14
235 0.14
236 0.13
237 0.16
238 0.14
239 0.09
240 0.08
241 0.07
242 0.07
243 0.07
244 0.07
245 0.04
246 0.04
247 0.05
248 0.06
249 0.06
250 0.07
251 0.07
252 0.08
253 0.13
254 0.12
255 0.13
256 0.14
257 0.14
258 0.15
259 0.16
260 0.17
261 0.12
262 0.13
263 0.12
264 0.11
265 0.1
266 0.09
267 0.09
268 0.07
269 0.07
270 0.07
271 0.07
272 0.07
273 0.07
274 0.07
275 0.07
276 0.08
277 0.08
278 0.08
279 0.08
280 0.09
281 0.09
282 0.09
283 0.08
284 0.1
285 0.11
286 0.11
287 0.11
288 0.11
289 0.1
290 0.1
291 0.11
292 0.1
293 0.08
294 0.08
295 0.07
296 0.08
297 0.08
298 0.08
299 0.07
300 0.06
301 0.06
302 0.06
303 0.05
304 0.04
305 0.04
306 0.05
307 0.05
308 0.06
309 0.06
310 0.07
311 0.08
312 0.1
313 0.12
314 0.11
315 0.11
316 0.11
317 0.1
318 0.1
319 0.11
320 0.09
321 0.08
322 0.08
323 0.08
324 0.1
325 0.1
326 0.1
327 0.1
328 0.09
329 0.1
330 0.1
331 0.12
332 0.14
333 0.23
334 0.23
335 0.26
336 0.28
337 0.27
338 0.3
339 0.32
340 0.28
341 0.2
342 0.2
343 0.17
344 0.17
345 0.18
346 0.15
347 0.12
348 0.12
349 0.11
350 0.11
351 0.09
352 0.07
353 0.05
354 0.08
355 0.09
356 0.12
357 0.14
358 0.16
359 0.18
360 0.22
361 0.24
362 0.24
363 0.25
364 0.28
365 0.29
366 0.27
367 0.24
368 0.2
369 0.18
370 0.16
371 0.14
372 0.07
373 0.04
374 0.04
375 0.05
376 0.06
377 0.05
378 0.05
379 0.05
380 0.06
381 0.06
382 0.06
383 0.07
384 0.07
385 0.08
386 0.1
387 0.11
388 0.13
389 0.13
390 0.12
391 0.11
392 0.1
393 0.11
394 0.09
395 0.09
396 0.07
397 0.07
398 0.07
399 0.07
400 0.07
401 0.07
402 0.1
403 0.09
404 0.11
405 0.13
406 0.15
407 0.17
408 0.16
409 0.16
410 0.13
411 0.14
412 0.13
413 0.11
414 0.09
415 0.08
416 0.1
417 0.1
418 0.09
419 0.09
420 0.09
421 0.12
422 0.13
423 0.13
424 0.12
425 0.12
426 0.19
427 0.21
428 0.2
429 0.17
430 0.17
431 0.17
432 0.17
433 0.17
434 0.11
435 0.09
436 0.11
437 0.11
438 0.12
439 0.14
440 0.15
441 0.15
442 0.17
443 0.23
444 0.23
445 0.23
446 0.21
447 0.2
448 0.19
449 0.18
450 0.16
451 0.1
452 0.08
453 0.08
454 0.09
455 0.09
456 0.1
457 0.11
458 0.11
459 0.13
460 0.15
461 0.15
462 0.16
463 0.22
464 0.23
465 0.24
466 0.26
467 0.26
468 0.25
469 0.24
470 0.25
471 0.28
472 0.27
473 0.27
474 0.32
475 0.32