Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6PVK2

Protein Details
Accession A0A2J6PVK2   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
22-49AIVLKSFGKAKRRPRKKPFLSDAHRLGRHydrophilic
NLS Segment(s)
PositionSequence
29-51GKAKRRPRKKPFLSDAHRLGRRR
Subcellular Location(s) mito 18.5, cyto_mito 11.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MSLKVLVTPSKSGKCLNTKTGAIVLKSFGKAKRRPRKKPFLSDAHRLGRRRHCRAERDMERDNGKVCWSDEVTFEVGEDLRTFFVTRGAGREEEYATKNLRPIFKSGRITVGVWSCFCGDEMGPLYMLPQGENMTAKRYKYVLQRLFIPFYERMRAKYGEEVVMQEDNAPWHRAKKNHEIPDEQGGEPYEIARTIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.52
3 0.53
4 0.52
5 0.48
6 0.48
7 0.51
8 0.46
9 0.38
10 0.33
11 0.29
12 0.27
13 0.28
14 0.3
15 0.29
16 0.35
17 0.41
18 0.51
19 0.6
20 0.67
21 0.76
22 0.83
23 0.89
24 0.9
25 0.93
26 0.91
27 0.9
28 0.86
29 0.84
30 0.81
31 0.79
32 0.75
33 0.67
34 0.66
35 0.66
36 0.69
37 0.68
38 0.71
39 0.69
40 0.71
41 0.76
42 0.79
43 0.77
44 0.74
45 0.7
46 0.65
47 0.6
48 0.54
49 0.47
50 0.36
51 0.29
52 0.24
53 0.19
54 0.18
55 0.17
56 0.16
57 0.15
58 0.17
59 0.17
60 0.15
61 0.14
62 0.11
63 0.09
64 0.09
65 0.08
66 0.06
67 0.05
68 0.06
69 0.07
70 0.06
71 0.08
72 0.09
73 0.09
74 0.11
75 0.12
76 0.12
77 0.13
78 0.14
79 0.13
80 0.14
81 0.16
82 0.16
83 0.15
84 0.15
85 0.17
86 0.18
87 0.21
88 0.19
89 0.22
90 0.26
91 0.32
92 0.35
93 0.33
94 0.33
95 0.32
96 0.31
97 0.29
98 0.26
99 0.21
100 0.17
101 0.17
102 0.14
103 0.13
104 0.13
105 0.11
106 0.07
107 0.08
108 0.1
109 0.1
110 0.09
111 0.09
112 0.09
113 0.1
114 0.1
115 0.08
116 0.07
117 0.07
118 0.08
119 0.1
120 0.1
121 0.14
122 0.17
123 0.17
124 0.18
125 0.19
126 0.23
127 0.3
128 0.4
129 0.41
130 0.41
131 0.47
132 0.49
133 0.51
134 0.46
135 0.42
136 0.35
137 0.32
138 0.38
139 0.32
140 0.31
141 0.33
142 0.34
143 0.31
144 0.34
145 0.34
146 0.29
147 0.29
148 0.27
149 0.25
150 0.24
151 0.22
152 0.16
153 0.15
154 0.14
155 0.16
156 0.17
157 0.16
158 0.23
159 0.3
160 0.35
161 0.42
162 0.5
163 0.58
164 0.65
165 0.7
166 0.67
167 0.65
168 0.68
169 0.65
170 0.54
171 0.46
172 0.38
173 0.33
174 0.28
175 0.24
176 0.16