Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6QB70

Protein Details
Accession A0A2J6QB70    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
37-79TQSRKSKHTIKTQPHPRHPRINMRNRPLRSTPRTKNIPRQREEHydrophilic
NLS Segment(s)
PositionSequence
43-77KHTIKTQPHPRHPRINMRNRPLRSTPRTKNIPRQR
Subcellular Location(s) mito 16, nucl 8, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSRQSLLSKQHREQIIRPRFLFLSLSLFPFPIPLFHTQSRKSKHTIKTQPHPRHPRINMRNRPLRSTPRTKNIPRQREELHPHVFRRIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.62
3 0.61
4 0.58
5 0.55
6 0.49
7 0.46
8 0.4
9 0.3
10 0.27
11 0.2
12 0.22
13 0.19
14 0.18
15 0.17
16 0.16
17 0.15
18 0.1
19 0.11
20 0.13
21 0.18
22 0.22
23 0.28
24 0.31
25 0.39
26 0.43
27 0.44
28 0.45
29 0.48
30 0.51
31 0.56
32 0.61
33 0.61
34 0.66
35 0.74
36 0.78
37 0.8
38 0.83
39 0.78
40 0.78
41 0.76
42 0.77
43 0.77
44 0.79
45 0.78
46 0.77
47 0.81
48 0.73
49 0.74
50 0.7
51 0.69
52 0.67
53 0.68
54 0.67
55 0.67
56 0.74
57 0.75
58 0.79
59 0.8
60 0.82
61 0.76
62 0.75
63 0.7
64 0.7
65 0.71
66 0.68
67 0.66
68 0.62
69 0.6