Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0T0Z0

Protein Details
Accession G0T0Z0    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
299-320KHSSRLSWSAYREKRKRRAMDPHydrophilic
NLS Segment(s)
PositionSequence
310-316REKRKRR
Subcellular Location(s) plas 18, extr 5, nucl 1, mito 1, pero 1, E.R. 1, mito_nucl 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPFLLLALALLNPLEPHQQPDLDNFGAGLEAEKTVRGRSEKAQEPGYYSQAVPAWTGPPPPPDNPRTLAPRAEAAALARTTRLLYISAAVGLDSLAGVCAVVLPWRMATTQGQWVAFALLAACSFGWLCTPIITSGYLQDLKKTRLAWFALLALAIVHAGMAAYFEAASLELRDGYVQRVCSETRRDWDAVESCRGGTKGPVIAFGLVGAILPVCSAPLLFLLWRSFSHLPQSHTYDTLFDNEVPPGWHVAPAELAPDSSASESDEEAKPALLGHSRKTSGPSMEWHELGKPGGGRSVKHSSRLSWSAYREKRKRRAMDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.17
4 0.2
5 0.22
6 0.23
7 0.27
8 0.32
9 0.27
10 0.26
11 0.22
12 0.19
13 0.16
14 0.15
15 0.12
16 0.07
17 0.07
18 0.08
19 0.1
20 0.11
21 0.12
22 0.17
23 0.19
24 0.22
25 0.28
26 0.37
27 0.43
28 0.47
29 0.51
30 0.47
31 0.5
32 0.5
33 0.46
34 0.38
35 0.3
36 0.29
37 0.25
38 0.25
39 0.2
40 0.17
41 0.16
42 0.15
43 0.18
44 0.17
45 0.22
46 0.25
47 0.29
48 0.35
49 0.37
50 0.4
51 0.41
52 0.44
53 0.45
54 0.44
55 0.42
56 0.37
57 0.36
58 0.32
59 0.29
60 0.24
61 0.18
62 0.19
63 0.17
64 0.15
65 0.13
66 0.12
67 0.12
68 0.12
69 0.12
70 0.08
71 0.08
72 0.09
73 0.09
74 0.09
75 0.09
76 0.08
77 0.07
78 0.06
79 0.05
80 0.04
81 0.03
82 0.03
83 0.02
84 0.02
85 0.02
86 0.02
87 0.02
88 0.04
89 0.04
90 0.05
91 0.05
92 0.06
93 0.06
94 0.08
95 0.1
96 0.11
97 0.16
98 0.19
99 0.19
100 0.18
101 0.18
102 0.17
103 0.15
104 0.12
105 0.07
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.05
115 0.05
116 0.06
117 0.07
118 0.07
119 0.08
120 0.08
121 0.08
122 0.08
123 0.11
124 0.14
125 0.13
126 0.17
127 0.19
128 0.2
129 0.23
130 0.23
131 0.22
132 0.24
133 0.25
134 0.21
135 0.19
136 0.18
137 0.15
138 0.13
139 0.11
140 0.06
141 0.05
142 0.04
143 0.03
144 0.02
145 0.02
146 0.02
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.02
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.04
160 0.04
161 0.05
162 0.07
163 0.08
164 0.09
165 0.09
166 0.11
167 0.12
168 0.15
169 0.2
170 0.21
171 0.22
172 0.26
173 0.26
174 0.25
175 0.28
176 0.29
177 0.26
178 0.26
179 0.23
180 0.19
181 0.2
182 0.2
183 0.16
184 0.12
185 0.12
186 0.13
187 0.13
188 0.14
189 0.13
190 0.13
191 0.13
192 0.12
193 0.09
194 0.05
195 0.05
196 0.04
197 0.03
198 0.02
199 0.02
200 0.02
201 0.02
202 0.02
203 0.02
204 0.03
205 0.03
206 0.04
207 0.05
208 0.07
209 0.08
210 0.09
211 0.1
212 0.16
213 0.17
214 0.17
215 0.27
216 0.29
217 0.32
218 0.35
219 0.41
220 0.36
221 0.36
222 0.35
223 0.28
224 0.25
225 0.24
226 0.21
227 0.15
228 0.15
229 0.14
230 0.15
231 0.14
232 0.13
233 0.13
234 0.12
235 0.13
236 0.12
237 0.12
238 0.13
239 0.12
240 0.13
241 0.1
242 0.1
243 0.08
244 0.08
245 0.09
246 0.08
247 0.08
248 0.08
249 0.09
250 0.09
251 0.13
252 0.13
253 0.14
254 0.13
255 0.13
256 0.12
257 0.12
258 0.13
259 0.16
260 0.17
261 0.21
262 0.28
263 0.29
264 0.31
265 0.34
266 0.37
267 0.35
268 0.35
269 0.36
270 0.37
271 0.4
272 0.39
273 0.36
274 0.33
275 0.31
276 0.29
277 0.27
278 0.21
279 0.17
280 0.23
281 0.24
282 0.24
283 0.29
284 0.39
285 0.38
286 0.44
287 0.45
288 0.42
289 0.49
290 0.52
291 0.51
292 0.47
293 0.51
294 0.55
295 0.61
296 0.69
297 0.71
298 0.77
299 0.81
300 0.85