Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6PTD5

Protein Details
Accession A0A2J6PTD5    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-27QSLTNPFRKLKDRRKLKGQRDLGSTSHydrophilic
NLS Segment(s)
PositionSequence
12-16KDRRK
Subcellular Location(s) mito 12, nucl 9, cyto_nucl 8.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR007751  DUF676_lipase-like  
Pfam View protein in Pfam  
PF05057  DUF676  
Amino Acid Sequences MQSLTNPFRKLKDRRKLKGQRDLGSTSNSSLAEAPTSLAPNRQETVIASSSDGLRTIQTPPRSVVDDTTEKYGLFLIHPTNPAPKNEEGRLGYALDIVAVHGITGSAYDTWTHSNGTFWLKDLIPKDFPGARVFSYAYPADVFCSFATGTIRSFARSLLECLKGERRSEEQLKRPTIFICHSMGGIIVKEALVLAKIEDELFENIRISVKGILFLATPHRGSGSTQFPSVVTGIANLALTGTSRFVGRMRSDLIENLKKDSKVLEDIATNFRKQTNSFQIASFIEQDITPPLKSRVCITSAWHIFPTKILTAMARLLMILVEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.86
3 0.9
4 0.91
5 0.91
6 0.89
7 0.85
8 0.81
9 0.76
10 0.68
11 0.62
12 0.53
13 0.44
14 0.38
15 0.31
16 0.25
17 0.22
18 0.2
19 0.15
20 0.14
21 0.14
22 0.12
23 0.15
24 0.14
25 0.18
26 0.2
27 0.22
28 0.23
29 0.23
30 0.21
31 0.2
32 0.26
33 0.24
34 0.22
35 0.19
36 0.19
37 0.19
38 0.19
39 0.18
40 0.12
41 0.11
42 0.11
43 0.16
44 0.21
45 0.24
46 0.26
47 0.28
48 0.3
49 0.33
50 0.32
51 0.29
52 0.29
53 0.31
54 0.3
55 0.32
56 0.3
57 0.26
58 0.25
59 0.24
60 0.18
61 0.13
62 0.15
63 0.13
64 0.15
65 0.17
66 0.18
67 0.24
68 0.26
69 0.27
70 0.29
71 0.31
72 0.34
73 0.34
74 0.39
75 0.33
76 0.33
77 0.32
78 0.28
79 0.23
80 0.18
81 0.16
82 0.1
83 0.08
84 0.06
85 0.05
86 0.04
87 0.04
88 0.03
89 0.03
90 0.03
91 0.03
92 0.04
93 0.04
94 0.04
95 0.05
96 0.06
97 0.08
98 0.09
99 0.1
100 0.09
101 0.1
102 0.12
103 0.15
104 0.14
105 0.14
106 0.16
107 0.15
108 0.18
109 0.2
110 0.21
111 0.19
112 0.19
113 0.22
114 0.21
115 0.22
116 0.2
117 0.2
118 0.17
119 0.17
120 0.18
121 0.15
122 0.16
123 0.15
124 0.13
125 0.12
126 0.11
127 0.11
128 0.1
129 0.11
130 0.08
131 0.09
132 0.08
133 0.09
134 0.1
135 0.09
136 0.09
137 0.11
138 0.11
139 0.1
140 0.11
141 0.1
142 0.11
143 0.11
144 0.13
145 0.15
146 0.17
147 0.16
148 0.18
149 0.24
150 0.24
151 0.24
152 0.24
153 0.23
154 0.27
155 0.35
156 0.39
157 0.41
158 0.47
159 0.5
160 0.48
161 0.46
162 0.41
163 0.36
164 0.31
165 0.25
166 0.2
167 0.16
168 0.15
169 0.14
170 0.14
171 0.11
172 0.09
173 0.07
174 0.05
175 0.04
176 0.04
177 0.04
178 0.03
179 0.03
180 0.03
181 0.03
182 0.04
183 0.04
184 0.04
185 0.04
186 0.06
187 0.07
188 0.08
189 0.09
190 0.09
191 0.09
192 0.1
193 0.1
194 0.09
195 0.11
196 0.1
197 0.11
198 0.11
199 0.11
200 0.1
201 0.11
202 0.14
203 0.13
204 0.14
205 0.13
206 0.13
207 0.13
208 0.15
209 0.19
210 0.21
211 0.21
212 0.21
213 0.21
214 0.2
215 0.21
216 0.2
217 0.15
218 0.09
219 0.07
220 0.07
221 0.07
222 0.07
223 0.05
224 0.05
225 0.05
226 0.05
227 0.05
228 0.06
229 0.05
230 0.06
231 0.07
232 0.08
233 0.14
234 0.15
235 0.18
236 0.2
237 0.21
238 0.23
239 0.26
240 0.33
241 0.34
242 0.33
243 0.35
244 0.37
245 0.35
246 0.35
247 0.33
248 0.28
249 0.26
250 0.27
251 0.24
252 0.22
253 0.26
254 0.33
255 0.34
256 0.31
257 0.28
258 0.29
259 0.29
260 0.29
261 0.35
262 0.37
263 0.4
264 0.41
265 0.4
266 0.42
267 0.4
268 0.4
269 0.32
270 0.23
271 0.18
272 0.16
273 0.17
274 0.18
275 0.19
276 0.17
277 0.18
278 0.21
279 0.23
280 0.24
281 0.27
282 0.27
283 0.28
284 0.29
285 0.31
286 0.38
287 0.39
288 0.41
289 0.4
290 0.37
291 0.34
292 0.35
293 0.35
294 0.25
295 0.22
296 0.21
297 0.19
298 0.2
299 0.22
300 0.21
301 0.15
302 0.14
303 0.13