Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6QEX7

Protein Details
Accession A0A2J6QEX7    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
59-80AYRDCKKQWITEKKEGKRREGKBasic
NLS Segment(s)
PositionSequence
74-77GKRR
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 3, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSSKDTPEETPWDSKTSEKFNSKRPGEFFDPCQEAASRSLKCLHRNGGDREMCTDYFQAYRDCKKQWITEKKEGKRREGKSWFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.37
4 0.4
5 0.44
6 0.45
7 0.52
8 0.61
9 0.61
10 0.61
11 0.57
12 0.56
13 0.52
14 0.52
15 0.46
16 0.42
17 0.41
18 0.36
19 0.34
20 0.28
21 0.23
22 0.24
23 0.25
24 0.19
25 0.17
26 0.24
27 0.26
28 0.29
29 0.31
30 0.32
31 0.33
32 0.38
33 0.42
34 0.44
35 0.42
36 0.39
37 0.39
38 0.38
39 0.32
40 0.28
41 0.24
42 0.16
43 0.15
44 0.17
45 0.18
46 0.19
47 0.25
48 0.29
49 0.3
50 0.35
51 0.38
52 0.45
53 0.52
54 0.58
55 0.61
56 0.67
57 0.75
58 0.78
59 0.83
60 0.81
61 0.8
62 0.79
63 0.76
64 0.77