Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6PHW3

Protein Details
Accession A0A2J6PHW3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
44-65DDGTPIPRKRRRRPAVCLNENQHydrophilic
NLS Segment(s)
PositionSequence
51-56RKRRRR
Subcellular Location(s) extr 9, E.R. 6, mito 4, plas 3, golg 2, vacu 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MPPHLHPRSRLTSSLFATTLFASFFVVALPHALPCPAPRVLYADDGTPIPRKRRRRPAVCLNENQSYETTESKDLVRPGVEEVEGDADVENEVEGEGGKRIAKRECPVPKPPGILGEILGFRSSSGEGKNRPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.41
3 0.33
4 0.3
5 0.27
6 0.22
7 0.15
8 0.12
9 0.09
10 0.08
11 0.08
12 0.07
13 0.06
14 0.06
15 0.07
16 0.07
17 0.06
18 0.07
19 0.07
20 0.07
21 0.08
22 0.12
23 0.12
24 0.12
25 0.12
26 0.17
27 0.18
28 0.21
29 0.21
30 0.17
31 0.17
32 0.17
33 0.18
34 0.19
35 0.21
36 0.26
37 0.33
38 0.42
39 0.51
40 0.62
41 0.71
42 0.74
43 0.8
44 0.83
45 0.86
46 0.83
47 0.78
48 0.71
49 0.66
50 0.57
51 0.49
52 0.38
53 0.29
54 0.23
55 0.19
56 0.16
57 0.12
58 0.12
59 0.12
60 0.14
61 0.13
62 0.13
63 0.12
64 0.11
65 0.12
66 0.12
67 0.11
68 0.08
69 0.08
70 0.09
71 0.08
72 0.08
73 0.06
74 0.05
75 0.05
76 0.05
77 0.05
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.04
84 0.05
85 0.08
86 0.09
87 0.13
88 0.18
89 0.23
90 0.27
91 0.36
92 0.44
93 0.49
94 0.56
95 0.59
96 0.59
97 0.57
98 0.54
99 0.48
100 0.4
101 0.34
102 0.28
103 0.25
104 0.21
105 0.18
106 0.17
107 0.14
108 0.12
109 0.13
110 0.13
111 0.12
112 0.16
113 0.23