Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6QIH9

Protein Details
Accession A0A2J6QIH9    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
103-128LIRIRTRKGRATLARRRAKKRSTLSHHydrophilic
NLS Segment(s)
PositionSequence
96-124RKRRHGFLIRIRTRKGRATLARRRAKKRS
Subcellular Location(s) mito 12, nucl 6, extr 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLCLRCSGGLNAIPMASTLTQPRTFTSLRGPSRPTIFPPTAAFRPSLAIISPATSTEVGVEATLDLLPRISSHPALGSTQIRCGPRNTFSPSHFVRKRRHGFLIRIRTRKGRATLARRRAKKRSTLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.12
4 0.11
5 0.13
6 0.17
7 0.2
8 0.21
9 0.23
10 0.26
11 0.25
12 0.26
13 0.31
14 0.35
15 0.37
16 0.41
17 0.43
18 0.42
19 0.46
20 0.46
21 0.41
22 0.4
23 0.36
24 0.34
25 0.34
26 0.35
27 0.33
28 0.32
29 0.28
30 0.21
31 0.21
32 0.19
33 0.17
34 0.11
35 0.1
36 0.09
37 0.1
38 0.09
39 0.08
40 0.09
41 0.08
42 0.08
43 0.07
44 0.07
45 0.06
46 0.06
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.03
53 0.03
54 0.03
55 0.04
56 0.05
57 0.07
58 0.07
59 0.07
60 0.09
61 0.1
62 0.1
63 0.13
64 0.15
65 0.14
66 0.16
67 0.2
68 0.21
69 0.22
70 0.24
71 0.24
72 0.24
73 0.29
74 0.33
75 0.33
76 0.33
77 0.39
78 0.4
79 0.47
80 0.49
81 0.51
82 0.53
83 0.6
84 0.66
85 0.65
86 0.71
87 0.68
88 0.71
89 0.74
90 0.77
91 0.76
92 0.74
93 0.72
94 0.71
95 0.68
96 0.67
97 0.62
98 0.6
99 0.61
100 0.65
101 0.72
102 0.75
103 0.8
104 0.82
105 0.86
106 0.86
107 0.84
108 0.83