Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6PGT6

Protein Details
Accession A0A2J6PGT6   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MACIPKRKTSRREYETPQRSRFRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 5.5, cyto_mito 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MACIPKRKTSRREYETPQRSRFRAYLEEGHSISRAAHLAKVPRSTARGWITTGDRRPGKERPGRPPIISDEKIEEITKWMTGHFDRRAIPLRQTTEIFDIKATNNTLSTAFTRFGYHHHIPDYKSFLTDKQKLKRWTFSIENWNRPKEYWQRSLYYDETTVQNTIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.84
4 0.82
5 0.78
6 0.72
7 0.7
8 0.63
9 0.57
10 0.53
11 0.49
12 0.49
13 0.46
14 0.48
15 0.43
16 0.41
17 0.36
18 0.3
19 0.25
20 0.18
21 0.15
22 0.11
23 0.13
24 0.15
25 0.21
26 0.25
27 0.27
28 0.28
29 0.28
30 0.31
31 0.29
32 0.34
33 0.32
34 0.29
35 0.27
36 0.29
37 0.31
38 0.35
39 0.37
40 0.37
41 0.35
42 0.36
43 0.4
44 0.42
45 0.46
46 0.49
47 0.53
48 0.54
49 0.61
50 0.62
51 0.58
52 0.55
53 0.52
54 0.52
55 0.46
56 0.38
57 0.31
58 0.29
59 0.3
60 0.27
61 0.2
62 0.14
63 0.13
64 0.13
65 0.1
66 0.09
67 0.1
68 0.11
69 0.16
70 0.16
71 0.18
72 0.18
73 0.22
74 0.27
75 0.26
76 0.29
77 0.28
78 0.29
79 0.29
80 0.29
81 0.27
82 0.26
83 0.26
84 0.22
85 0.18
86 0.16
87 0.15
88 0.17
89 0.16
90 0.12
91 0.12
92 0.12
93 0.12
94 0.12
95 0.13
96 0.12
97 0.12
98 0.12
99 0.13
100 0.13
101 0.15
102 0.22
103 0.23
104 0.24
105 0.27
106 0.3
107 0.3
108 0.34
109 0.38
110 0.29
111 0.29
112 0.27
113 0.29
114 0.35
115 0.41
116 0.46
117 0.48
118 0.57
119 0.64
120 0.68
121 0.71
122 0.66
123 0.65
124 0.62
125 0.61
126 0.63
127 0.63
128 0.68
129 0.66
130 0.67
131 0.61
132 0.56
133 0.57
134 0.56
135 0.56
136 0.55
137 0.54
138 0.54
139 0.55
140 0.6
141 0.54
142 0.48
143 0.41
144 0.35
145 0.32
146 0.3