Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6PWK8

Protein Details
Accession A0A2J6PWK8    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
108-139TVAKILKRHNKAKRRSCKKPYLTIRHKKLRRVBasic
NLS Segment(s)
PositionSequence
68-69KK
112-153ILKRHNKAKRRSCKKPYLTIRHKKLRRVHSRFELKIKRNPRK
Subcellular Location(s) nucl 12, mito 11.5, cyto_nucl 8.833, cyto_mito 8.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MGLPPKKLNAHLTLREKERILTLKDEGHGPSAIWHKTKIPRSIISSFLNRYAKTDNSTLIRKPGSGAKKKLLARAERALVHITVNDPRMTLKALSTPSKSGKQLNHYTVAKILKRHNKAKRRSCKKPYLTIRHKKLRRVHSRFELKIKRNPRKVIWSDKVTFKIGEDLINFWITRGPGRDEEYAKKNLKPSFKSGRVTVGAWGCFCGDELGALYILPPGENMNAKWYKQVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.62
3 0.57
4 0.51
5 0.49
6 0.46
7 0.41
8 0.38
9 0.37
10 0.36
11 0.36
12 0.38
13 0.32
14 0.28
15 0.25
16 0.2
17 0.22
18 0.24
19 0.27
20 0.26
21 0.26
22 0.3
23 0.39
24 0.46
25 0.49
26 0.48
27 0.5
28 0.55
29 0.56
30 0.55
31 0.51
32 0.48
33 0.43
34 0.45
35 0.44
36 0.37
37 0.37
38 0.36
39 0.34
40 0.32
41 0.32
42 0.28
43 0.29
44 0.32
45 0.31
46 0.32
47 0.3
48 0.27
49 0.27
50 0.31
51 0.36
52 0.4
53 0.44
54 0.43
55 0.5
56 0.53
57 0.57
58 0.56
59 0.51
60 0.48
61 0.48
62 0.47
63 0.4
64 0.39
65 0.35
66 0.28
67 0.24
68 0.18
69 0.15
70 0.14
71 0.14
72 0.13
73 0.11
74 0.11
75 0.12
76 0.13
77 0.12
78 0.1
79 0.12
80 0.16
81 0.19
82 0.2
83 0.23
84 0.25
85 0.28
86 0.3
87 0.3
88 0.31
89 0.35
90 0.4
91 0.39
92 0.42
93 0.39
94 0.37
95 0.37
96 0.37
97 0.31
98 0.29
99 0.34
100 0.36
101 0.42
102 0.51
103 0.56
104 0.6
105 0.69
106 0.75
107 0.79
108 0.8
109 0.84
110 0.84
111 0.85
112 0.82
113 0.82
114 0.82
115 0.82
116 0.83
117 0.83
118 0.83
119 0.83
120 0.81
121 0.79
122 0.77
123 0.77
124 0.78
125 0.75
126 0.73
127 0.73
128 0.78
129 0.73
130 0.75
131 0.73
132 0.67
133 0.68
134 0.71
135 0.71
136 0.7
137 0.72
138 0.67
139 0.68
140 0.69
141 0.71
142 0.67
143 0.65
144 0.6
145 0.6
146 0.58
147 0.5
148 0.43
149 0.33
150 0.3
151 0.24
152 0.23
153 0.18
154 0.17
155 0.16
156 0.18
157 0.17
158 0.12
159 0.14
160 0.12
161 0.14
162 0.15
163 0.17
164 0.19
165 0.24
166 0.29
167 0.31
168 0.37
169 0.4
170 0.46
171 0.45
172 0.44
173 0.47
174 0.47
175 0.52
176 0.5
177 0.53
178 0.55
179 0.59
180 0.61
181 0.56
182 0.58
183 0.52
184 0.48
185 0.45
186 0.39
187 0.33
188 0.29
189 0.28
190 0.21
191 0.19
192 0.18
193 0.14
194 0.09
195 0.08
196 0.09
197 0.09
198 0.09
199 0.08
200 0.08
201 0.08
202 0.08
203 0.08
204 0.07
205 0.07
206 0.11
207 0.14
208 0.15
209 0.22
210 0.27
211 0.28