Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6PKE6

Protein Details
Accession A0A2J6PKE6   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
66-93AIAELKQRLKSKPKPKNKQDHQQDEGTFHydrophilic
277-300STSSHKPKYKHPKKPPLIPPKPQQHydrophilic
NLS Segment(s)
PositionSequence
74-81LKSKPKPK
282-294KPKYKHPKKPPLI
Subcellular Location(s) nucl 13, mito 9, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016193  Cytidine_deaminase-like  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006139  P:nucleobase-containing compound metabolic process  
Amino Acid Sequences MSPRNDTFLSLCLAQAELSPLHYRHGSIIVRGGKVLGQGFNCYHPGFDGGALKSGVLPSASLDGPAIAELKQRLKSKPKPKNKQDHQQDEGTFTPFESTGCGPHANAHLSMHSEMMAIRASKNRASSYRVILKNGKPEHAVSKPTQQRSAPRRRQQAPAKPTVASSLFKSRVLNPVHLNQVSKENDNDSNVKEEDNEFHEVKEDVALNTWKGAEKHRPKKYGYESYQNGYQYKQSHDHETQQRHYQHKRGVEPQLSKTTVKGVRNPDTPSSSSDDDSTSSHKPKYKHPKKPPLIPPKPQQILITKKQSLNAKADVKERTKDLRLKGSDLYVARLGACQVTAPSDSKSKQHASARSPPAPTPSSKSEPASLYDELSPLSRTPSPSTTPVNPPMIKPEIRASRPCYRCVSAMHAVGIKRVFWTNADGEWEGAKVRDLVEALEKGIEGDGDGPGTGQENKGVFVTKHEVLMLKRIMGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.14
4 0.11
5 0.14
6 0.18
7 0.18
8 0.21
9 0.22
10 0.22
11 0.21
12 0.29
13 0.27
14 0.25
15 0.32
16 0.34
17 0.34
18 0.33
19 0.31
20 0.24
21 0.26
22 0.26
23 0.22
24 0.18
25 0.22
26 0.23
27 0.26
28 0.28
29 0.24
30 0.22
31 0.19
32 0.2
33 0.17
34 0.18
35 0.21
36 0.18
37 0.22
38 0.21
39 0.2
40 0.19
41 0.18
42 0.16
43 0.1
44 0.1
45 0.08
46 0.11
47 0.11
48 0.1
49 0.1
50 0.09
51 0.1
52 0.1
53 0.1
54 0.07
55 0.1
56 0.14
57 0.19
58 0.26
59 0.31
60 0.38
61 0.47
62 0.57
63 0.64
64 0.72
65 0.78
66 0.82
67 0.88
68 0.92
69 0.92
70 0.93
71 0.93
72 0.92
73 0.85
74 0.81
75 0.72
76 0.65
77 0.57
78 0.48
79 0.37
80 0.27
81 0.24
82 0.16
83 0.15
84 0.14
85 0.13
86 0.12
87 0.14
88 0.15
89 0.14
90 0.17
91 0.21
92 0.2
93 0.2
94 0.19
95 0.18
96 0.2
97 0.2
98 0.17
99 0.13
100 0.11
101 0.1
102 0.1
103 0.11
104 0.09
105 0.11
106 0.15
107 0.18
108 0.2
109 0.24
110 0.27
111 0.28
112 0.33
113 0.35
114 0.38
115 0.45
116 0.45
117 0.46
118 0.49
119 0.5
120 0.54
121 0.52
122 0.47
123 0.39
124 0.39
125 0.4
126 0.37
127 0.38
128 0.31
129 0.38
130 0.43
131 0.45
132 0.48
133 0.45
134 0.5
135 0.56
136 0.65
137 0.66
138 0.67
139 0.73
140 0.73
141 0.8
142 0.8
143 0.8
144 0.76
145 0.74
146 0.68
147 0.58
148 0.54
149 0.48
150 0.4
151 0.31
152 0.27
153 0.26
154 0.26
155 0.27
156 0.28
157 0.26
158 0.32
159 0.33
160 0.34
161 0.29
162 0.31
163 0.35
164 0.35
165 0.33
166 0.26
167 0.32
168 0.3
169 0.28
170 0.25
171 0.23
172 0.23
173 0.25
174 0.26
175 0.19
176 0.21
177 0.2
178 0.19
179 0.17
180 0.16
181 0.15
182 0.17
183 0.2
184 0.16
185 0.16
186 0.17
187 0.16
188 0.15
189 0.15
190 0.12
191 0.08
192 0.1
193 0.11
194 0.1
195 0.1
196 0.1
197 0.1
198 0.11
199 0.15
200 0.23
201 0.32
202 0.43
203 0.5
204 0.55
205 0.55
206 0.62
207 0.67
208 0.67
209 0.6
210 0.59
211 0.54
212 0.51
213 0.53
214 0.46
215 0.38
216 0.29
217 0.28
218 0.22
219 0.23
220 0.26
221 0.24
222 0.29
223 0.3
224 0.38
225 0.41
226 0.44
227 0.44
228 0.46
229 0.5
230 0.5
231 0.52
232 0.5
233 0.47
234 0.48
235 0.49
236 0.48
237 0.5
238 0.49
239 0.49
240 0.47
241 0.48
242 0.44
243 0.4
244 0.34
245 0.34
246 0.33
247 0.32
248 0.34
249 0.35
250 0.39
251 0.42
252 0.45
253 0.4
254 0.39
255 0.38
256 0.34
257 0.32
258 0.27
259 0.24
260 0.22
261 0.2
262 0.17
263 0.17
264 0.18
265 0.18
266 0.2
267 0.23
268 0.26
269 0.28
270 0.37
271 0.47
272 0.54
273 0.61
274 0.69
275 0.77
276 0.8
277 0.88
278 0.89
279 0.89
280 0.87
281 0.83
282 0.8
283 0.78
284 0.73
285 0.65
286 0.57
287 0.54
288 0.53
289 0.53
290 0.53
291 0.48
292 0.47
293 0.5
294 0.52
295 0.48
296 0.45
297 0.45
298 0.42
299 0.41
300 0.44
301 0.46
302 0.44
303 0.42
304 0.41
305 0.39
306 0.4
307 0.44
308 0.43
309 0.46
310 0.45
311 0.46
312 0.44
313 0.4
314 0.38
315 0.32
316 0.3
317 0.22
318 0.2
319 0.17
320 0.15
321 0.14
322 0.1
323 0.09
324 0.07
325 0.06
326 0.07
327 0.09
328 0.1
329 0.12
330 0.17
331 0.19
332 0.22
333 0.28
334 0.29
335 0.34
336 0.4
337 0.45
338 0.47
339 0.56
340 0.61
341 0.6
342 0.59
343 0.53
344 0.52
345 0.48
346 0.43
347 0.39
348 0.38
349 0.39
350 0.4
351 0.41
352 0.39
353 0.38
354 0.39
355 0.38
356 0.31
357 0.28
358 0.25
359 0.23
360 0.19
361 0.18
362 0.16
363 0.11
364 0.15
365 0.15
366 0.18
367 0.22
368 0.26
369 0.29
370 0.32
371 0.38
372 0.39
373 0.43
374 0.47
375 0.5
376 0.47
377 0.44
378 0.46
379 0.46
380 0.42
381 0.38
382 0.4
383 0.42
384 0.45
385 0.51
386 0.51
387 0.55
388 0.58
389 0.6
390 0.57
391 0.51
392 0.49
393 0.47
394 0.47
395 0.43
396 0.42
397 0.4
398 0.37
399 0.34
400 0.35
401 0.32
402 0.25
403 0.21
404 0.21
405 0.19
406 0.17
407 0.21
408 0.2
409 0.2
410 0.25
411 0.23
412 0.22
413 0.21
414 0.2
415 0.16
416 0.15
417 0.14
418 0.1
419 0.1
420 0.12
421 0.12
422 0.13
423 0.17
424 0.18
425 0.17
426 0.17
427 0.16
428 0.14
429 0.14
430 0.12
431 0.07
432 0.07
433 0.07
434 0.07
435 0.07
436 0.07
437 0.07
438 0.09
439 0.1
440 0.1
441 0.14
442 0.14
443 0.16
444 0.17
445 0.2
446 0.18
447 0.23
448 0.29
449 0.25
450 0.26
451 0.27
452 0.3
453 0.27
454 0.36
455 0.32