Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0SV56

Protein Details
Accession G0SV56   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
524-544LETYNRLRVEHERKRKVRRSVBasic
NLS Segment(s)
PositionSequence
536-542RKRKVRR
Subcellular Location(s) mito 10, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR032675  LRR_dom_sf  
IPR000630  Ribosomal_S8  
IPR035987  Ribosomal_S8_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00410  Ribosomal_S8  
Amino Acid Sequences MARHRWVPIAPTRQHLSILSLLLAHGFISSVSYGSTNTSPVSPPDPSSYVSARPSERRVWAELKYRNDRPVLRKMSLVSMPSRKVVLDKDEIRRFVKGSRVKFVRGLTLGELAVVANERGIFEGRDAIRQGLGGEVIARPSIERLRYREWGVSDTRREGGSWAWWLAILRARPEVGQYCQEFNLLATFDSRTGQVAAEDEELSLDDVADLCRAMPNLTTFALSGPRFVSLLPVVLSTLPRLHIVTLREIDPDFWPPSLATRPLPELSLEQPTQLRALEIHNKEFGEAFHLEMSTMIASRILDIVRASPLIETLILRNTPGPEALNDILDAHPNSHLLQRLYVDIQNPRGPPERNGPDYVGESWKLVTSLSRYIQSLPGLETLIIGKECTVFDERSVDALKARKPLRTLAFKEQSFGYSGDTIHDLLPFLKTLSPSHLPRHLVLDYDISGSAEESILDWLPVYANEEFPTEEEVYGDGYRRPKWWHDGSYEEVVRIKEFGDSVNLRMSGRIFEGLPLKPVRDEDLETYNRLRVEHERKRKVRRSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.44
3 0.39
4 0.32
5 0.3
6 0.24
7 0.19
8 0.18
9 0.16
10 0.15
11 0.1
12 0.07
13 0.05
14 0.05
15 0.06
16 0.07
17 0.06
18 0.07
19 0.08
20 0.08
21 0.12
22 0.13
23 0.13
24 0.13
25 0.15
26 0.16
27 0.19
28 0.23
29 0.22
30 0.23
31 0.28
32 0.29
33 0.29
34 0.32
35 0.32
36 0.33
37 0.34
38 0.37
39 0.37
40 0.4
41 0.44
42 0.45
43 0.49
44 0.48
45 0.5
46 0.49
47 0.51
48 0.54
49 0.56
50 0.6
51 0.62
52 0.63
53 0.62
54 0.64
55 0.65
56 0.62
57 0.65
58 0.63
59 0.56
60 0.54
61 0.51
62 0.5
63 0.46
64 0.43
65 0.39
66 0.39
67 0.39
68 0.38
69 0.36
70 0.3
71 0.3
72 0.31
73 0.3
74 0.32
75 0.37
76 0.45
77 0.51
78 0.54
79 0.53
80 0.51
81 0.46
82 0.42
83 0.44
84 0.42
85 0.41
86 0.47
87 0.49
88 0.5
89 0.53
90 0.5
91 0.48
92 0.41
93 0.38
94 0.3
95 0.28
96 0.25
97 0.2
98 0.18
99 0.11
100 0.1
101 0.09
102 0.07
103 0.05
104 0.05
105 0.05
106 0.06
107 0.08
108 0.08
109 0.07
110 0.15
111 0.15
112 0.18
113 0.19
114 0.19
115 0.18
116 0.18
117 0.17
118 0.11
119 0.1
120 0.07
121 0.07
122 0.07
123 0.07
124 0.07
125 0.07
126 0.06
127 0.09
128 0.13
129 0.18
130 0.22
131 0.27
132 0.33
133 0.37
134 0.4
135 0.41
136 0.38
137 0.37
138 0.39
139 0.4
140 0.38
141 0.37
142 0.35
143 0.32
144 0.3
145 0.27
146 0.22
147 0.19
148 0.18
149 0.15
150 0.13
151 0.14
152 0.14
153 0.14
154 0.17
155 0.15
156 0.14
157 0.15
158 0.15
159 0.15
160 0.18
161 0.19
162 0.18
163 0.22
164 0.22
165 0.23
166 0.23
167 0.23
168 0.2
169 0.17
170 0.16
171 0.11
172 0.09
173 0.08
174 0.08
175 0.09
176 0.09
177 0.09
178 0.08
179 0.09
180 0.09
181 0.08
182 0.08
183 0.09
184 0.1
185 0.1
186 0.08
187 0.08
188 0.08
189 0.08
190 0.07
191 0.05
192 0.04
193 0.04
194 0.04
195 0.04
196 0.04
197 0.04
198 0.05
199 0.05
200 0.06
201 0.06
202 0.07
203 0.09
204 0.1
205 0.1
206 0.09
207 0.1
208 0.15
209 0.14
210 0.14
211 0.12
212 0.12
213 0.12
214 0.12
215 0.13
216 0.08
217 0.09
218 0.08
219 0.08
220 0.08
221 0.08
222 0.08
223 0.07
224 0.08
225 0.07
226 0.08
227 0.08
228 0.08
229 0.11
230 0.12
231 0.15
232 0.16
233 0.16
234 0.16
235 0.16
236 0.16
237 0.14
238 0.16
239 0.14
240 0.12
241 0.12
242 0.11
243 0.13
244 0.14
245 0.15
246 0.12
247 0.13
248 0.15
249 0.15
250 0.16
251 0.14
252 0.14
253 0.13
254 0.17
255 0.16
256 0.14
257 0.14
258 0.14
259 0.14
260 0.12
261 0.11
262 0.07
263 0.1
264 0.18
265 0.19
266 0.2
267 0.21
268 0.21
269 0.21
270 0.21
271 0.18
272 0.13
273 0.12
274 0.11
275 0.1
276 0.1
277 0.09
278 0.09
279 0.09
280 0.05
281 0.05
282 0.04
283 0.04
284 0.04
285 0.05
286 0.06
287 0.05
288 0.06
289 0.06
290 0.07
291 0.07
292 0.07
293 0.07
294 0.06
295 0.06
296 0.06
297 0.06
298 0.06
299 0.06
300 0.08
301 0.08
302 0.08
303 0.09
304 0.1
305 0.1
306 0.1
307 0.1
308 0.08
309 0.12
310 0.12
311 0.12
312 0.11
313 0.11
314 0.11
315 0.12
316 0.12
317 0.08
318 0.08
319 0.09
320 0.1
321 0.11
322 0.14
323 0.13
324 0.14
325 0.14
326 0.15
327 0.17
328 0.18
329 0.18
330 0.18
331 0.21
332 0.24
333 0.23
334 0.25
335 0.29
336 0.29
337 0.29
338 0.36
339 0.39
340 0.38
341 0.4
342 0.38
343 0.34
344 0.35
345 0.33
346 0.26
347 0.2
348 0.17
349 0.15
350 0.14
351 0.12
352 0.1
353 0.1
354 0.1
355 0.15
356 0.16
357 0.18
358 0.18
359 0.19
360 0.22
361 0.22
362 0.2
363 0.16
364 0.15
365 0.14
366 0.13
367 0.12
368 0.09
369 0.1
370 0.09
371 0.07
372 0.07
373 0.08
374 0.08
375 0.1
376 0.13
377 0.12
378 0.13
379 0.16
380 0.16
381 0.17
382 0.18
383 0.16
384 0.16
385 0.21
386 0.23
387 0.28
388 0.3
389 0.31
390 0.32
391 0.39
392 0.43
393 0.48
394 0.51
395 0.53
396 0.6
397 0.57
398 0.57
399 0.5
400 0.43
401 0.36
402 0.3
403 0.22
404 0.15
405 0.15
406 0.15
407 0.15
408 0.15
409 0.13
410 0.13
411 0.11
412 0.1
413 0.11
414 0.1
415 0.1
416 0.11
417 0.12
418 0.12
419 0.18
420 0.24
421 0.27
422 0.32
423 0.38
424 0.38
425 0.38
426 0.42
427 0.36
428 0.31
429 0.29
430 0.26
431 0.21
432 0.2
433 0.19
434 0.14
435 0.13
436 0.11
437 0.11
438 0.08
439 0.07
440 0.06
441 0.07
442 0.07
443 0.07
444 0.07
445 0.06
446 0.07
447 0.07
448 0.1
449 0.1
450 0.11
451 0.12
452 0.13
453 0.13
454 0.14
455 0.18
456 0.16
457 0.15
458 0.14
459 0.13
460 0.15
461 0.15
462 0.16
463 0.15
464 0.19
465 0.21
466 0.25
467 0.3
468 0.33
469 0.41
470 0.48
471 0.51
472 0.51
473 0.54
474 0.56
475 0.6
476 0.55
477 0.47
478 0.42
479 0.36
480 0.32
481 0.27
482 0.21
483 0.15
484 0.14
485 0.14
486 0.19
487 0.19
488 0.21
489 0.26
490 0.26
491 0.25
492 0.26
493 0.26
494 0.2
495 0.2
496 0.21
497 0.16
498 0.18
499 0.23
500 0.23
501 0.28
502 0.28
503 0.27
504 0.27
505 0.28
506 0.29
507 0.28
508 0.3
509 0.28
510 0.35
511 0.36
512 0.38
513 0.39
514 0.37
515 0.35
516 0.31
517 0.31
518 0.33
519 0.41
520 0.49
521 0.58
522 0.66
523 0.74
524 0.85