Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6QQA7

Protein Details
Accession A0A2J6QQA7   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
87-114GDHPKSSSKGRIEKRRHHRKASIVFPKYBasic
NLS Segment(s)
PositionSequence
91-127KSSSKGRIEKRRHHRKASIVFPKYRKGKRVGGPKGKK
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKGARASTTKTNHQNLKSKVFGPIESARTERLSAKLLELASQPKPKPLKEDIVMDLEQGAAENSEVPAQGKQSEDMEIDQETTKNGDHPKSSSKGRIEKRRHHRKASIVFPKYRKGKRVGGPKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.71
3 0.68
4 0.7
5 0.64
6 0.57
7 0.56
8 0.5
9 0.43
10 0.4
11 0.4
12 0.35
13 0.33
14 0.33
15 0.28
16 0.27
17 0.28
18 0.24
19 0.2
20 0.2
21 0.19
22 0.19
23 0.2
24 0.18
25 0.18
26 0.18
27 0.19
28 0.21
29 0.27
30 0.26
31 0.3
32 0.33
33 0.33
34 0.37
35 0.37
36 0.39
37 0.35
38 0.39
39 0.34
40 0.35
41 0.34
42 0.27
43 0.23
44 0.16
45 0.13
46 0.09
47 0.07
48 0.03
49 0.03
50 0.03
51 0.03
52 0.04
53 0.04
54 0.04
55 0.05
56 0.06
57 0.07
58 0.07
59 0.08
60 0.09
61 0.1
62 0.1
63 0.1
64 0.11
65 0.1
66 0.1
67 0.1
68 0.09
69 0.08
70 0.09
71 0.09
72 0.11
73 0.15
74 0.16
75 0.18
76 0.21
77 0.27
78 0.31
79 0.35
80 0.39
81 0.43
82 0.49
83 0.57
84 0.65
85 0.68
86 0.74
87 0.81
88 0.85
89 0.86
90 0.86
91 0.84
92 0.83
93 0.83
94 0.83
95 0.83
96 0.78
97 0.78
98 0.73
99 0.75
100 0.75
101 0.73
102 0.69
103 0.66
104 0.68
105 0.68
106 0.75
107 0.77