Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6Q2P9

Protein Details
Accession A0A2J6Q2P9    Localization Confidence High Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-35IELFRLEQRYTRRRNRRSTFVSEAHydrophilic
81-100LEKMDWRRGREDKRQNRVSVHydrophilic
NLS Segment(s)
PositionSequence
71-81KGSKRLSKMGL
83-83K
86-90WRRGR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MVNIFDLISQKIELFRLEQRYTRRRNRRSTFVSEAQYVDGEYIYSPTSTYSAKCSAGGSDSEEESRSKESKGSKRLSKMGLEKMDWRRGREDKRQNRVSVREVKWDEEIRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.2
3 0.26
4 0.28
5 0.33
6 0.41
7 0.49
8 0.58
9 0.66
10 0.71
11 0.72
12 0.81
13 0.83
14 0.84
15 0.82
16 0.8
17 0.77
18 0.73
19 0.67
20 0.58
21 0.51
22 0.41
23 0.34
24 0.25
25 0.17
26 0.11
27 0.07
28 0.06
29 0.06
30 0.05
31 0.05
32 0.05
33 0.05
34 0.07
35 0.07
36 0.08
37 0.11
38 0.13
39 0.13
40 0.14
41 0.13
42 0.12
43 0.13
44 0.13
45 0.12
46 0.1
47 0.1
48 0.1
49 0.11
50 0.11
51 0.11
52 0.14
53 0.12
54 0.12
55 0.15
56 0.23
57 0.31
58 0.39
59 0.46
60 0.49
61 0.54
62 0.59
63 0.59
64 0.57
65 0.55
66 0.54
67 0.51
68 0.46
69 0.49
70 0.5
71 0.56
72 0.53
73 0.49
74 0.49
75 0.54
76 0.6
77 0.63
78 0.67
79 0.68
80 0.76
81 0.81
82 0.8
83 0.79
84 0.77
85 0.75
86 0.74
87 0.67
88 0.66
89 0.61
90 0.58
91 0.57