Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6PRZ7

Protein Details
Accession A0A2J6PRZ7    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPSQQLFEKTHRRPRRERCQHLNNHPPYHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MPSQQLFEKTHRRPRRERCQHLNNHPPYHTLNHSHPQYHTLGHNLKIILMEDDLVRQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.86
3 0.86
4 0.88
5 0.87
6 0.88
7 0.89
8 0.89
9 0.88
10 0.84
11 0.76
12 0.67
13 0.59
14 0.51
15 0.44
16 0.37
17 0.31
18 0.28
19 0.32
20 0.33
21 0.33
22 0.31
23 0.31
24 0.29
25 0.27
26 0.24
27 0.24
28 0.25
29 0.26
30 0.29
31 0.25
32 0.24
33 0.23
34 0.23
35 0.17
36 0.14
37 0.13
38 0.1