Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6PVG2

Protein Details
Accession A0A2J6PVG2    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
109-130LADKLKNKLFKKKIAKEDKVAAHydrophilic
NLS Segment(s)
PositionSequence
114-124KNKLFKKKIAK
Subcellular Location(s) cyto 12.5, cyto_nucl 12.5, nucl 9.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MSARNSTEVSHGRGGAGNIGVDNTPYGDGEIVREGPVGDHNDGAFSTGRGGAANIGSPGIKATVRKDEMAIPEVALRPSMEGENFHVGRGGEGNVHVAEKNNTKHPEGLADKLKNKLFKKKIAKEDKVAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.22
3 0.19
4 0.14
5 0.11
6 0.12
7 0.11
8 0.09
9 0.09
10 0.07
11 0.07
12 0.07
13 0.07
14 0.07
15 0.07
16 0.08
17 0.1
18 0.1
19 0.09
20 0.1
21 0.09
22 0.09
23 0.12
24 0.14
25 0.13
26 0.13
27 0.12
28 0.13
29 0.13
30 0.14
31 0.1
32 0.07
33 0.08
34 0.07
35 0.07
36 0.07
37 0.07
38 0.06
39 0.06
40 0.06
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.07
49 0.09
50 0.15
51 0.17
52 0.17
53 0.18
54 0.2
55 0.21
56 0.22
57 0.2
58 0.13
59 0.14
60 0.14
61 0.13
62 0.11
63 0.09
64 0.07
65 0.08
66 0.08
67 0.07
68 0.07
69 0.1
70 0.17
71 0.17
72 0.16
73 0.17
74 0.16
75 0.16
76 0.16
77 0.14
78 0.08
79 0.08
80 0.1
81 0.08
82 0.09
83 0.09
84 0.1
85 0.13
86 0.18
87 0.21
88 0.28
89 0.31
90 0.32
91 0.34
92 0.33
93 0.38
94 0.36
95 0.4
96 0.41
97 0.44
98 0.46
99 0.5
100 0.54
101 0.54
102 0.56
103 0.6
104 0.58
105 0.62
106 0.7
107 0.73
108 0.8
109 0.82
110 0.84