Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6PHB7

Protein Details
Accession A0A2J6PHB7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
31-53TEAIRAWKRRCHRRRPIFSTHSWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 1.5, cyto_nucl 1.5
Family & Domain DBs
Amino Acid Sequences MLLVRTRPLLTRKPVTLVWSRRYLAMLALVTEAIRAWKRRCHRRRPIFSTHSWTSVMSPWVKQENQYVKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.5
4 0.49
5 0.46
6 0.45
7 0.44
8 0.4
9 0.39
10 0.35
11 0.26
12 0.22
13 0.17
14 0.11
15 0.11
16 0.1
17 0.09
18 0.08
19 0.07
20 0.06
21 0.08
22 0.1
23 0.12
24 0.19
25 0.28
26 0.39
27 0.49
28 0.58
29 0.67
30 0.76
31 0.85
32 0.86
33 0.88
34 0.83
35 0.79
36 0.76
37 0.68
38 0.59
39 0.49
40 0.42
41 0.33
42 0.3
43 0.29
44 0.23
45 0.21
46 0.24
47 0.3
48 0.3
49 0.31
50 0.37