Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6PMU8

Protein Details
Accession A0A2J6PMU8    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
166-191IAPKVRAWLKARTRRKKLLPWQPLGVHydrophilic
NLS Segment(s)
PositionSequence
174-182LKARTRRKK
Subcellular Location(s) mito 17.5, cyto_mito 11, nucl 4, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MADTHPLPMGGGVGMRRAHHAVASVSRALRMIYLGHPYPAAAKHRTKAPIHLNIGEILSFNDLQTLAAFFQEGPGQDVAVLRNIRSLSISYLDDHAAADWRRRTTDYAYEAFELLYASWHLMQVSWLELCLPCWDAVSSVDDPGIWSLLKIRGLPHLTISGPHRCIAPKVRAWLKARTRRKKLLPWQPLGVENPGPNNWTAFLTHRDGQPPWQQQYEWLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.19
4 0.2
5 0.2
6 0.19
7 0.21
8 0.2
9 0.22
10 0.25
11 0.25
12 0.23
13 0.23
14 0.23
15 0.2
16 0.17
17 0.14
18 0.13
19 0.12
20 0.17
21 0.18
22 0.18
23 0.18
24 0.17
25 0.19
26 0.22
27 0.25
28 0.25
29 0.29
30 0.32
31 0.39
32 0.46
33 0.44
34 0.48
35 0.51
36 0.54
37 0.54
38 0.52
39 0.46
40 0.41
41 0.39
42 0.31
43 0.22
44 0.14
45 0.11
46 0.1
47 0.08
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.06
54 0.06
55 0.06
56 0.05
57 0.06
58 0.08
59 0.08
60 0.09
61 0.09
62 0.09
63 0.09
64 0.1
65 0.09
66 0.13
67 0.13
68 0.11
69 0.13
70 0.14
71 0.13
72 0.13
73 0.14
74 0.1
75 0.12
76 0.13
77 0.11
78 0.12
79 0.12
80 0.11
81 0.11
82 0.09
83 0.11
84 0.1
85 0.13
86 0.15
87 0.16
88 0.17
89 0.18
90 0.2
91 0.2
92 0.25
93 0.26
94 0.25
95 0.25
96 0.24
97 0.23
98 0.21
99 0.18
100 0.11
101 0.07
102 0.06
103 0.04
104 0.04
105 0.04
106 0.05
107 0.05
108 0.04
109 0.05
110 0.05
111 0.06
112 0.05
113 0.05
114 0.06
115 0.06
116 0.06
117 0.07
118 0.07
119 0.06
120 0.07
121 0.07
122 0.07
123 0.08
124 0.12
125 0.11
126 0.1
127 0.1
128 0.1
129 0.1
130 0.09
131 0.09
132 0.05
133 0.05
134 0.07
135 0.1
136 0.12
137 0.12
138 0.13
139 0.19
140 0.21
141 0.22
142 0.21
143 0.21
144 0.19
145 0.22
146 0.25
147 0.25
148 0.24
149 0.24
150 0.24
151 0.23
152 0.27
153 0.32
154 0.35
155 0.33
156 0.4
157 0.45
158 0.51
159 0.54
160 0.59
161 0.63
162 0.66
163 0.73
164 0.75
165 0.78
166 0.8
167 0.85
168 0.86
169 0.86
170 0.86
171 0.85
172 0.8
173 0.77
174 0.7
175 0.65
176 0.57
177 0.5
178 0.42
179 0.34
180 0.32
181 0.27
182 0.26
183 0.23
184 0.21
185 0.19
186 0.17
187 0.17
188 0.17
189 0.21
190 0.25
191 0.29
192 0.31
193 0.34
194 0.34
195 0.39
196 0.46
197 0.49
198 0.48
199 0.49
200 0.45