Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6Q012

Protein Details
Accession A0A2J6Q012   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
107-128AATPNHKQKTRRRQLPHLALDIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 10, cyto_nucl 9, cyto 5
Family & Domain DBs
Amino Acid Sequences MGFRRLFKSKKPAFVSRTYHGSTPGGNFGEQRSEDEILIVRHISPSQIIDASAFTPKPAAQVKNTSTPLNHQKNLRPRFSAVTVDVAQQTIPGAWPEDDDEPVPAPAATPNHKQKTRRRQLPHLALDIGSASVHQKQRYLHNQPSSDDSFIVTHPSPTEIFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.73
3 0.67
4 0.66
5 0.58
6 0.52
7 0.46
8 0.41
9 0.34
10 0.3
11 0.3
12 0.24
13 0.22
14 0.22
15 0.2
16 0.25
17 0.23
18 0.23
19 0.22
20 0.22
21 0.21
22 0.21
23 0.22
24 0.16
25 0.17
26 0.14
27 0.1
28 0.1
29 0.1
30 0.1
31 0.09
32 0.09
33 0.1
34 0.1
35 0.1
36 0.09
37 0.1
38 0.1
39 0.12
40 0.1
41 0.09
42 0.09
43 0.09
44 0.13
45 0.17
46 0.19
47 0.19
48 0.26
49 0.29
50 0.36
51 0.38
52 0.35
53 0.3
54 0.34
55 0.41
56 0.41
57 0.41
58 0.37
59 0.41
60 0.5
61 0.56
62 0.53
63 0.45
64 0.4
65 0.41
66 0.39
67 0.35
68 0.26
69 0.23
70 0.21
71 0.2
72 0.18
73 0.15
74 0.12
75 0.1
76 0.09
77 0.05
78 0.05
79 0.04
80 0.05
81 0.05
82 0.06
83 0.08
84 0.09
85 0.09
86 0.09
87 0.1
88 0.1
89 0.09
90 0.09
91 0.07
92 0.07
93 0.08
94 0.12
95 0.15
96 0.22
97 0.31
98 0.4
99 0.45
100 0.53
101 0.61
102 0.69
103 0.76
104 0.78
105 0.77
106 0.79
107 0.85
108 0.87
109 0.82
110 0.74
111 0.64
112 0.54
113 0.46
114 0.36
115 0.26
116 0.15
117 0.1
118 0.08
119 0.13
120 0.17
121 0.18
122 0.21
123 0.24
124 0.34
125 0.44
126 0.51
127 0.53
128 0.58
129 0.6
130 0.59
131 0.63
132 0.57
133 0.48
134 0.4
135 0.33
136 0.26
137 0.23
138 0.27
139 0.2
140 0.18
141 0.17
142 0.2