Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0SY92

Protein Details
Accession G0SY92    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MCRCRRTSVSRKQRKTRADSRLYGHydrophilic
NLS Segment(s)
PositionSequence
11-46RKQRKTRADSRLYGIKAKAWRGYKPASGGKSVARRR
Subcellular Location(s) nucl 15, cyto_nucl 11, mito 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MCRCRRTSVSRKQRKTRADSRLYGIKAKAWRGYKPASGGKSVARRRPASCSAPGINWQNGAPGNSMRELLGERGEGESGDEEEDSEAACGRPGQLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.87
4 0.86
5 0.83
6 0.77
7 0.72
8 0.71
9 0.63
10 0.58
11 0.48
12 0.43
13 0.39
14 0.38
15 0.39
16 0.34
17 0.35
18 0.36
19 0.39
20 0.36
21 0.38
22 0.4
23 0.35
24 0.34
25 0.32
26 0.32
27 0.38
28 0.4
29 0.4
30 0.4
31 0.41
32 0.41
33 0.46
34 0.47
35 0.41
36 0.38
37 0.38
38 0.33
39 0.31
40 0.33
41 0.31
42 0.25
43 0.22
44 0.2
45 0.18
46 0.17
47 0.17
48 0.14
49 0.12
50 0.13
51 0.12
52 0.13
53 0.11
54 0.11
55 0.11
56 0.11
57 0.11
58 0.1
59 0.1
60 0.1
61 0.1
62 0.09
63 0.09
64 0.09
65 0.09
66 0.09
67 0.08
68 0.08
69 0.08
70 0.08
71 0.07
72 0.07
73 0.07
74 0.06
75 0.07
76 0.07