Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6QJI9

Protein Details
Accession A0A2J6QJI9    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
66-85MDAPRPKTVKKNNINYHLSRHydrophilic
NLS Segment(s)
PositionSequence
95-97KRK
Subcellular Location(s) nucl 12, mito 12, mito_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MPPKGASTKLQPMRLPPLPKLRVRRPNQADANPCLALMSSVLTCWASSGYTAAGCQVLETQLRACMDAPRPKTVKKNNINYHLSRMYPNIVGPRKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.55
3 0.51
4 0.55
5 0.55
6 0.6
7 0.64
8 0.66
9 0.69
10 0.71
11 0.75
12 0.72
13 0.75
14 0.76
15 0.74
16 0.68
17 0.62
18 0.6
19 0.49
20 0.42
21 0.32
22 0.24
23 0.17
24 0.12
25 0.09
26 0.05
27 0.04
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.04
34 0.04
35 0.05
36 0.05
37 0.04
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.06
45 0.06
46 0.07
47 0.07
48 0.09
49 0.1
50 0.1
51 0.11
52 0.14
53 0.21
54 0.27
55 0.3
56 0.35
57 0.38
58 0.42
59 0.51
60 0.57
61 0.6
62 0.63
63 0.71
64 0.72
65 0.79
66 0.81
67 0.74
68 0.72
69 0.65
70 0.57
71 0.48
72 0.42
73 0.36
74 0.31
75 0.31
76 0.33
77 0.38