Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6QGV3

Protein Details
Accession A0A2J6QGV3   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
33-59LTTKLVCTNCKRKKKRCDKRLASCSLCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
Amino Acid Sequences MECLSFQSGRRTPTGIAILKINDRISGSEGGILTTKLVCTNCKRKKKRCDKRLASCSLCTRYSTWKSTWLFDSVRPDDRSPRACGCCLYSVHIFKLYLLVSIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.33
3 0.31
4 0.31
5 0.31
6 0.3
7 0.33
8 0.27
9 0.2
10 0.19
11 0.18
12 0.19
13 0.18
14 0.16
15 0.15
16 0.15
17 0.14
18 0.14
19 0.12
20 0.1
21 0.08
22 0.08
23 0.08
24 0.09
25 0.12
26 0.19
27 0.3
28 0.39
29 0.5
30 0.6
31 0.67
32 0.78
33 0.85
34 0.9
35 0.89
36 0.91
37 0.9
38 0.91
39 0.9
40 0.86
41 0.78
42 0.7
43 0.64
44 0.57
45 0.48
46 0.39
47 0.32
48 0.33
49 0.35
50 0.34
51 0.31
52 0.35
53 0.36
54 0.37
55 0.37
56 0.33
57 0.29
58 0.29
59 0.36
60 0.31
61 0.37
62 0.37
63 0.37
64 0.4
65 0.45
66 0.46
67 0.43
68 0.47
69 0.43
70 0.42
71 0.42
72 0.39
73 0.37
74 0.34
75 0.34
76 0.34
77 0.33
78 0.34
79 0.36
80 0.32
81 0.28
82 0.31
83 0.26