Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6QGW5

Protein Details
Accession A0A2J6QGW5   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
55-78LAVLLFCTRRRRRRNRYATPMTSQHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, mito 6, nucl 5, plas 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR020999  Chitin_synth_reg_RCR  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF12273  RCR  
Amino Acid Sequences MYLIPRDTTAITEFAKRQYYYDSPCNYYGNCHSAWYRWGRWVLAGVLLFIGLVFLAVLLFCTRRRRRRNRYATPMTSQAPLGGYNSGYGNGNQHYNPPSGPPPQYGNPNGNTGYDGYYGQQSGVAQPQNAYKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.3
4 0.29
5 0.32
6 0.36
7 0.38
8 0.44
9 0.44
10 0.43
11 0.45
12 0.46
13 0.39
14 0.38
15 0.36
16 0.31
17 0.26
18 0.24
19 0.23
20 0.22
21 0.28
22 0.29
23 0.26
24 0.28
25 0.29
26 0.27
27 0.27
28 0.27
29 0.23
30 0.19
31 0.17
32 0.13
33 0.1
34 0.1
35 0.09
36 0.06
37 0.05
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.03
46 0.04
47 0.06
48 0.16
49 0.24
50 0.34
51 0.45
52 0.56
53 0.66
54 0.76
55 0.85
56 0.86
57 0.89
58 0.88
59 0.82
60 0.75
61 0.69
62 0.59
63 0.49
64 0.38
65 0.28
66 0.19
67 0.15
68 0.13
69 0.09
70 0.08
71 0.08
72 0.08
73 0.08
74 0.08
75 0.08
76 0.1
77 0.1
78 0.12
79 0.12
80 0.15
81 0.17
82 0.17
83 0.17
84 0.19
85 0.21
86 0.24
87 0.27
88 0.26
89 0.29
90 0.32
91 0.39
92 0.39
93 0.4
94 0.38
95 0.39
96 0.37
97 0.32
98 0.3
99 0.23
100 0.22
101 0.18
102 0.16
103 0.14
104 0.15
105 0.15
106 0.13
107 0.14
108 0.12
109 0.13
110 0.19
111 0.2
112 0.19
113 0.2