Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6PY41

Protein Details
Accession A0A2J6PY41    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
76-96VQTRKKTAKKGWKRMINKPMFHydrophilic
NLS Segment(s)
PositionSequence
79-89RKKTAKKGWKR
Subcellular Location(s) nucl 13, cyto 10, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039411  NSA2_fam  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005840  C:ribosome  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
Amino Acid Sequences MKKQIKALEESCLNSSAPNEPSTTPLPQYLLDRSNPTNAKALSSAIKNKRNEKAAKFSVPLPKVRAIAEEELFTVVQTRKKTAKKGWKRMINKPMFVGRDFTRRPVKYERFIWPMGLRYKKANVTHPELGVTIQLPIISVRKKPAKPNGTIIEVNFSELGLVTVVVEVISGRWAQITNNCENDGCVNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.23
4 0.21
5 0.2
6 0.2
7 0.19
8 0.23
9 0.26
10 0.27
11 0.24
12 0.23
13 0.24
14 0.23
15 0.26
16 0.27
17 0.27
18 0.27
19 0.3
20 0.3
21 0.36
22 0.36
23 0.34
24 0.36
25 0.32
26 0.32
27 0.28
28 0.28
29 0.24
30 0.27
31 0.34
32 0.36
33 0.44
34 0.47
35 0.53
36 0.57
37 0.62
38 0.64
39 0.61
40 0.62
41 0.6
42 0.6
43 0.54
44 0.52
45 0.53
46 0.49
47 0.46
48 0.4
49 0.38
50 0.35
51 0.33
52 0.3
53 0.24
54 0.25
55 0.22
56 0.19
57 0.16
58 0.15
59 0.15
60 0.12
61 0.12
62 0.11
63 0.14
64 0.14
65 0.18
66 0.24
67 0.29
68 0.35
69 0.41
70 0.51
71 0.58
72 0.68
73 0.73
74 0.75
75 0.78
76 0.81
77 0.82
78 0.76
79 0.66
80 0.57
81 0.53
82 0.45
83 0.39
84 0.33
85 0.24
86 0.28
87 0.27
88 0.3
89 0.34
90 0.33
91 0.37
92 0.43
93 0.47
94 0.45
95 0.49
96 0.5
97 0.46
98 0.46
99 0.44
100 0.36
101 0.36
102 0.37
103 0.36
104 0.31
105 0.29
106 0.33
107 0.37
108 0.38
109 0.41
110 0.4
111 0.43
112 0.45
113 0.43
114 0.39
115 0.33
116 0.3
117 0.23
118 0.18
119 0.1
120 0.07
121 0.07
122 0.06
123 0.07
124 0.11
125 0.12
126 0.14
127 0.21
128 0.3
129 0.34
130 0.43
131 0.52
132 0.55
133 0.58
134 0.65
135 0.62
136 0.59
137 0.57
138 0.49
139 0.44
140 0.37
141 0.34
142 0.25
143 0.2
144 0.14
145 0.12
146 0.12
147 0.06
148 0.06
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.05
157 0.05
158 0.05
159 0.06
160 0.07
161 0.1
162 0.16
163 0.21
164 0.26
165 0.3
166 0.31
167 0.3
168 0.31