Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0SXJ0

Protein Details
Accession G0SXJ0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
21-41GVSEGLKRARRPFRTRNMITGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, pero 10, cyto 4, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018628  Coa3_cc  
IPR005399  K_chnl_volt-dep_bsu_KCNAB-rel  
IPR023210  NADP_OxRdtase_dom  
IPR036812  NADP_OxRdtase_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00248  Aldo_ket_red  
PF09813  Coa3_cc  
Amino Acid Sequences MADSGLTSRQARATYHPKGYGVSEGLKRARRPFRTRNMITGGLISAFAFSVYMYSIRAVAQDDFADLAEPVSEDTRRNLRSIEEEKRYSEALVADRLAPQPGIAAEAPQPTAAAAPVPGRRSILQMVQGAFGGRGAESKIVWGAPSVDRLGRIGAEVPQEQYSRRLVGESEIAMGQAFKELDVDRSQIVVTTKIFFGTGKSDPNQRGLSRKHIIEGMRASLKRLQLDYVDVVFCHRPDVATPIEETVRAFSWVIDQGWAFYWGTSEWSSQQIQEAIGIADRLGLHRPVVEQPQYSILHREKFEVEYAPLFKNYGLGTTIWSPLAGGELSGKYANGIPEDSRWKTNPNFYEKQIKEYESPEGQARQAKIRKLGDIAKRLDSTTAAVALAWCAKNPNVSTVILGATKVEQLEENFKALDVLPKITDDIVKEIDEIFENKPDQLPTYGRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.5
3 0.51
4 0.48
5 0.48
6 0.48
7 0.44
8 0.38
9 0.36
10 0.33
11 0.37
12 0.42
13 0.47
14 0.5
15 0.54
16 0.61
17 0.64
18 0.7
19 0.74
20 0.78
21 0.82
22 0.81
23 0.8
24 0.76
25 0.69
26 0.6
27 0.51
28 0.41
29 0.3
30 0.26
31 0.18
32 0.12
33 0.09
34 0.08
35 0.06
36 0.05
37 0.05
38 0.06
39 0.06
40 0.07
41 0.07
42 0.08
43 0.08
44 0.1
45 0.12
46 0.12
47 0.13
48 0.12
49 0.12
50 0.12
51 0.12
52 0.11
53 0.09
54 0.08
55 0.06
56 0.06
57 0.07
58 0.08
59 0.1
60 0.1
61 0.15
62 0.23
63 0.25
64 0.26
65 0.26
66 0.26
67 0.34
68 0.41
69 0.45
70 0.45
71 0.46
72 0.47
73 0.48
74 0.46
75 0.37
76 0.32
77 0.26
78 0.21
79 0.21
80 0.19
81 0.18
82 0.19
83 0.2
84 0.18
85 0.15
86 0.12
87 0.11
88 0.1
89 0.12
90 0.1
91 0.1
92 0.12
93 0.14
94 0.14
95 0.13
96 0.13
97 0.1
98 0.1
99 0.09
100 0.07
101 0.06
102 0.1
103 0.14
104 0.16
105 0.16
106 0.18
107 0.19
108 0.22
109 0.23
110 0.22
111 0.24
112 0.26
113 0.26
114 0.24
115 0.24
116 0.2
117 0.18
118 0.15
119 0.1
120 0.06
121 0.06
122 0.06
123 0.07
124 0.07
125 0.07
126 0.08
127 0.08
128 0.08
129 0.08
130 0.09
131 0.09
132 0.12
133 0.12
134 0.12
135 0.13
136 0.13
137 0.13
138 0.1
139 0.1
140 0.09
141 0.1
142 0.12
143 0.13
144 0.14
145 0.16
146 0.16
147 0.16
148 0.18
149 0.17
150 0.16
151 0.15
152 0.14
153 0.12
154 0.13
155 0.15
156 0.12
157 0.12
158 0.1
159 0.1
160 0.09
161 0.09
162 0.07
163 0.06
164 0.06
165 0.05
166 0.06
167 0.07
168 0.09
169 0.1
170 0.12
171 0.1
172 0.1
173 0.1
174 0.11
175 0.11
176 0.11
177 0.1
178 0.11
179 0.11
180 0.1
181 0.11
182 0.09
183 0.09
184 0.12
185 0.13
186 0.14
187 0.16
188 0.21
189 0.22
190 0.27
191 0.29
192 0.26
193 0.31
194 0.31
195 0.38
196 0.36
197 0.35
198 0.32
199 0.32
200 0.32
201 0.29
202 0.27
203 0.22
204 0.23
205 0.22
206 0.23
207 0.22
208 0.23
209 0.21
210 0.2
211 0.18
212 0.14
213 0.16
214 0.15
215 0.13
216 0.11
217 0.09
218 0.11
219 0.1
220 0.1
221 0.09
222 0.08
223 0.07
224 0.07
225 0.11
226 0.1
227 0.1
228 0.11
229 0.11
230 0.11
231 0.12
232 0.11
233 0.09
234 0.08
235 0.09
236 0.08
237 0.07
238 0.09
239 0.11
240 0.11
241 0.1
242 0.09
243 0.09
244 0.1
245 0.11
246 0.09
247 0.07
248 0.07
249 0.07
250 0.09
251 0.09
252 0.1
253 0.09
254 0.12
255 0.13
256 0.13
257 0.14
258 0.13
259 0.12
260 0.11
261 0.11
262 0.08
263 0.07
264 0.07
265 0.06
266 0.06
267 0.06
268 0.07
269 0.08
270 0.08
271 0.08
272 0.09
273 0.1
274 0.12
275 0.17
276 0.19
277 0.18
278 0.18
279 0.24
280 0.25
281 0.24
282 0.28
283 0.26
284 0.29
285 0.29
286 0.3
287 0.26
288 0.26
289 0.28
290 0.23
291 0.21
292 0.19
293 0.21
294 0.2
295 0.19
296 0.18
297 0.16
298 0.16
299 0.15
300 0.13
301 0.11
302 0.1
303 0.12
304 0.13
305 0.14
306 0.12
307 0.12
308 0.1
309 0.09
310 0.1
311 0.08
312 0.06
313 0.07
314 0.07
315 0.09
316 0.09
317 0.09
318 0.08
319 0.11
320 0.11
321 0.1
322 0.12
323 0.11
324 0.16
325 0.23
326 0.25
327 0.27
328 0.28
329 0.32
330 0.35
331 0.43
332 0.45
333 0.47
334 0.49
335 0.49
336 0.59
337 0.53
338 0.56
339 0.52
340 0.48
341 0.42
342 0.4
343 0.42
344 0.33
345 0.35
346 0.32
347 0.29
348 0.3
349 0.32
350 0.32
351 0.35
352 0.39
353 0.41
354 0.45
355 0.46
356 0.46
357 0.45
358 0.52
359 0.51
360 0.53
361 0.53
362 0.5
363 0.48
364 0.46
365 0.42
366 0.35
367 0.28
368 0.22
369 0.19
370 0.13
371 0.12
372 0.11
373 0.12
374 0.16
375 0.14
376 0.13
377 0.14
378 0.15
379 0.21
380 0.22
381 0.25
382 0.22
383 0.23
384 0.23
385 0.22
386 0.23
387 0.18
388 0.17
389 0.14
390 0.12
391 0.13
392 0.12
393 0.11
394 0.11
395 0.13
396 0.2
397 0.21
398 0.22
399 0.2
400 0.2
401 0.2
402 0.19
403 0.23
404 0.18
405 0.2
406 0.19
407 0.2
408 0.21
409 0.21
410 0.23
411 0.18
412 0.2
413 0.2
414 0.2
415 0.2
416 0.19
417 0.19
418 0.19
419 0.2
420 0.18
421 0.21
422 0.22
423 0.22
424 0.25
425 0.25
426 0.26
427 0.28