Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0T242

Protein Details
Accession G0T242    Localization Confidence High Confidence Score 18.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-37ANAHKAKSSTQKKSQPKDPKKGARTIPHydrophilic
NLS Segment(s)
PositionSequence
8-40KPPANAHKAKSSTQKKSQPKDPKKGARTIPPKK
87-94AREEKAKK
Subcellular Location(s) nucl 24, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MPQSFKSKPPANAHKAKSSTQKKSQPKDPKKGARTIPPKKANLVTKQQVHRRTTSSHASALEKEIAAQAMSHGKLTIMRKAAEEVKAREEKAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.7
3 0.67
4 0.68
5 0.67
6 0.67
7 0.67
8 0.73
9 0.74
10 0.77
11 0.82
12 0.83
13 0.83
14 0.85
15 0.85
16 0.86
17 0.81
18 0.81
19 0.76
20 0.74
21 0.75
22 0.73
23 0.73
24 0.7
25 0.67
26 0.62
27 0.63
28 0.59
29 0.54
30 0.53
31 0.49
32 0.48
33 0.53
34 0.56
35 0.58
36 0.54
37 0.5
38 0.45
39 0.42
40 0.41
41 0.4
42 0.36
43 0.31
44 0.31
45 0.3
46 0.28
47 0.27
48 0.23
49 0.17
50 0.15
51 0.13
52 0.11
53 0.09
54 0.08
55 0.07
56 0.11
57 0.11
58 0.11
59 0.1
60 0.1
61 0.16
62 0.19
63 0.23
64 0.22
65 0.23
66 0.24
67 0.28
68 0.32
69 0.34
70 0.38
71 0.36
72 0.41
73 0.45
74 0.45