Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6QAR6

Protein Details
Accession A0A2J6QAR6    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-33IFDCGHSKPSKRVKCKKPTSKCGGVFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 12.166, cyto_nucl 5.833, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MCHNVTQIFDCGHSKPSKRVKCKKPTSKCGGVFLRQELENTKGLCLKSVQQEQSIAAAGGREDEGYWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.36
3 0.46
4 0.53
5 0.62
6 0.71
7 0.75
8 0.81
9 0.89
10 0.9
11 0.9
12 0.9
13 0.88
14 0.87
15 0.78
16 0.75
17 0.68
18 0.61
19 0.52
20 0.44
21 0.37
22 0.28
23 0.26
24 0.2
25 0.19
26 0.18
27 0.17
28 0.16
29 0.17
30 0.17
31 0.18
32 0.17
33 0.19
34 0.23
35 0.3
36 0.31
37 0.3
38 0.31
39 0.31
40 0.31
41 0.27
42 0.19
43 0.12
44 0.11
45 0.09
46 0.09
47 0.09
48 0.07