Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6PFB0

Protein Details
Accession A0A2J6PFB0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-25GAKAASKRARKDKDDKGVAKBasic
NLS Segment(s)
PositionSequence
10-18ASKRARKDK
Subcellular Location(s) mito 15, nucl 9, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039713  At2g23090-like  
IPR039438  At2g23090-like_Znf  
IPR026939  ZNF706/At2g23090_sf  
Pfam View protein in Pfam  
PF12907  zf-met2  
Amino Acid Sequences MGGGNGAKAASKRARKDKDDKGVAKSQLKVNEQAKDIQCNICKSTFLKTTRAPALTEHATNKHSKTLEDCFPNFVAQPAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.73
4 0.76
5 0.78
6 0.8
7 0.75
8 0.71
9 0.7
10 0.68
11 0.63
12 0.56
13 0.5
14 0.47
15 0.45
16 0.46
17 0.42
18 0.4
19 0.37
20 0.4
21 0.37
22 0.33
23 0.33
24 0.29
25 0.29
26 0.27
27 0.27
28 0.21
29 0.21
30 0.19
31 0.22
32 0.26
33 0.25
34 0.29
35 0.29
36 0.34
37 0.38
38 0.38
39 0.34
40 0.28
41 0.31
42 0.29
43 0.29
44 0.27
45 0.25
46 0.26
47 0.29
48 0.29
49 0.29
50 0.27
51 0.26
52 0.29
53 0.32
54 0.37
55 0.41
56 0.4
57 0.38
58 0.38
59 0.39
60 0.34