Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6PUH4

Protein Details
Accession A0A2J6PUH4   
Localization Confidence High
Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-124IDSFRGDRDRSPRRERARTPQTDSWHPSSRDRSPRRRSRTPPRRDRSPVRDNWRARPRSPMRARTPPRRFSPRRDDDRRPRSPARRDERRRSRSPYDRDRPAPRTBasic
NLS Segment(s)
PositionSequence
13-169RPRSPPRIDSFRGDRDRSPRRERARTPQTDSWHPSSRDRSPRRRSRTPPRRDRSPVRDNWRARPRSPMRARTPPRRFSPRRDDDRRPRSPARRDERRRSRSPYDRDRPAPRTRSPFPRRSPPAGPRASYRGRSRSLERRDDRAPTGPSSSNWRRRSP
213-224RSPPPRERSPPA
228-258YRERESARSTPRERSPIRPVAPRSPPRGPAG
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MGGGESYRPAGARPRSPPRIDSFRGDRDRSPRRERARTPQTDSWHPSSRDRSPRRRSRTPPRRDRSPVRDNWRARPRSPMRARTPPRRFSPRRDDDRRPRSPARRDERRRSRSPYDRDRPAPRTRSPFPRRSPPAGPRASYRGRSRSLERRDDRAPTGPSSSNWRRRSPSPPARDSERSSERTSGNTSRRSSPPTHPERLHLTQAVTRDSRPRSPPPRERSPPAQLAYRERESARSTPRERSPIRPVAPRSPPRGPAGFRAPTGPSGGRNFAAPSPSSTSSISSMSAHTRPENSGPVIPPSGPRGYVPPTRGGYSIRGGRGGFGGERISRPDTSAWGAAPPSRPAAVEIPARAVSLASRPAPTPSPTIPSGPAVSIPTGPSGGIPTGPRAGVPRPSLQHSSIVYNSRLNVALSSNLGPRPHPAMANLPQIIPGGRIDPTASGIPSDIAARLKRKEEEAEILREELHAKQEKLRQGLKGWDKLSRDSQSMALRTELSERHVRMLAGEGVGGAAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.61
3 0.65
4 0.69
5 0.68
6 0.7
7 0.66
8 0.65
9 0.63
10 0.65
11 0.69
12 0.67
13 0.65
14 0.66
15 0.72
16 0.73
17 0.74
18 0.74
19 0.75
20 0.82
21 0.83
22 0.84
23 0.85
24 0.84
25 0.84
26 0.81
27 0.78
28 0.77
29 0.76
30 0.72
31 0.7
32 0.64
33 0.63
34 0.63
35 0.66
36 0.67
37 0.71
38 0.75
39 0.77
40 0.84
41 0.86
42 0.89
43 0.9
44 0.9
45 0.91
46 0.91
47 0.91
48 0.89
49 0.9
50 0.89
51 0.9
52 0.88
53 0.88
54 0.86
55 0.84
56 0.85
57 0.8
58 0.81
59 0.81
60 0.77
61 0.68
62 0.69
63 0.68
64 0.69
65 0.73
66 0.73
67 0.71
68 0.76
69 0.84
70 0.84
71 0.86
72 0.84
73 0.83
74 0.84
75 0.82
76 0.81
77 0.83
78 0.82
79 0.83
80 0.84
81 0.85
82 0.85
83 0.89
84 0.88
85 0.85
86 0.84
87 0.83
88 0.84
89 0.84
90 0.83
91 0.84
92 0.86
93 0.89
94 0.9
95 0.89
96 0.88
97 0.86
98 0.86
99 0.85
100 0.85
101 0.84
102 0.82
103 0.82
104 0.82
105 0.82
106 0.79
107 0.79
108 0.76
109 0.72
110 0.71
111 0.69
112 0.72
113 0.72
114 0.74
115 0.71
116 0.75
117 0.75
118 0.74
119 0.76
120 0.72
121 0.73
122 0.69
123 0.64
124 0.57
125 0.58
126 0.56
127 0.54
128 0.54
129 0.5
130 0.5
131 0.52
132 0.56
133 0.58
134 0.61
135 0.65
136 0.61
137 0.6
138 0.59
139 0.6
140 0.56
141 0.52
142 0.46
143 0.38
144 0.39
145 0.35
146 0.32
147 0.37
148 0.43
149 0.46
150 0.48
151 0.52
152 0.52
153 0.55
154 0.62
155 0.64
156 0.64
157 0.63
158 0.64
159 0.63
160 0.65
161 0.66
162 0.61
163 0.59
164 0.56
165 0.51
166 0.48
167 0.48
168 0.42
169 0.39
170 0.41
171 0.4
172 0.39
173 0.42
174 0.42
175 0.43
176 0.45
177 0.48
178 0.47
179 0.47
180 0.51
181 0.52
182 0.56
183 0.51
184 0.52
185 0.55
186 0.53
187 0.49
188 0.4
189 0.34
190 0.29
191 0.3
192 0.3
193 0.23
194 0.21
195 0.24
196 0.26
197 0.3
198 0.34
199 0.41
200 0.47
201 0.56
202 0.64
203 0.65
204 0.72
205 0.72
206 0.73
207 0.7
208 0.68
209 0.64
210 0.57
211 0.54
212 0.46
213 0.46
214 0.46
215 0.41
216 0.36
217 0.3
218 0.31
219 0.3
220 0.33
221 0.33
222 0.35
223 0.37
224 0.41
225 0.45
226 0.5
227 0.49
228 0.5
229 0.52
230 0.52
231 0.52
232 0.52
233 0.52
234 0.51
235 0.58
236 0.57
237 0.55
238 0.5
239 0.5
240 0.47
241 0.47
242 0.4
243 0.36
244 0.37
245 0.33
246 0.29
247 0.28
248 0.26
249 0.23
250 0.24
251 0.2
252 0.15
253 0.16
254 0.17
255 0.15
256 0.14
257 0.15
258 0.13
259 0.14
260 0.12
261 0.12
262 0.16
263 0.17
264 0.18
265 0.17
266 0.18
267 0.18
268 0.18
269 0.17
270 0.13
271 0.13
272 0.14
273 0.15
274 0.15
275 0.15
276 0.16
277 0.16
278 0.18
279 0.19
280 0.17
281 0.18
282 0.17
283 0.19
284 0.18
285 0.17
286 0.16
287 0.17
288 0.16
289 0.14
290 0.14
291 0.15
292 0.19
293 0.24
294 0.24
295 0.26
296 0.27
297 0.28
298 0.29
299 0.27
300 0.25
301 0.25
302 0.28
303 0.23
304 0.23
305 0.22
306 0.21
307 0.2
308 0.18
309 0.13
310 0.1
311 0.11
312 0.1
313 0.11
314 0.14
315 0.16
316 0.15
317 0.16
318 0.16
319 0.16
320 0.17
321 0.18
322 0.15
323 0.14
324 0.14
325 0.15
326 0.16
327 0.16
328 0.15
329 0.14
330 0.14
331 0.15
332 0.17
333 0.18
334 0.19
335 0.18
336 0.19
337 0.19
338 0.19
339 0.17
340 0.14
341 0.11
342 0.11
343 0.14
344 0.13
345 0.14
346 0.14
347 0.17
348 0.2
349 0.21
350 0.23
351 0.21
352 0.24
353 0.24
354 0.26
355 0.25
356 0.25
357 0.24
358 0.19
359 0.19
360 0.16
361 0.15
362 0.14
363 0.13
364 0.12
365 0.11
366 0.11
367 0.09
368 0.1
369 0.09
370 0.1
371 0.1
372 0.12
373 0.13
374 0.13
375 0.14
376 0.15
377 0.18
378 0.22
379 0.25
380 0.29
381 0.3
382 0.35
383 0.39
384 0.37
385 0.39
386 0.35
387 0.36
388 0.34
389 0.35
390 0.32
391 0.3
392 0.29
393 0.26
394 0.25
395 0.21
396 0.18
397 0.15
398 0.14
399 0.14
400 0.16
401 0.17
402 0.19
403 0.19
404 0.19
405 0.2
406 0.24
407 0.24
408 0.23
409 0.22
410 0.28
411 0.33
412 0.4
413 0.38
414 0.32
415 0.31
416 0.31
417 0.29
418 0.22
419 0.17
420 0.11
421 0.11
422 0.11
423 0.11
424 0.11
425 0.14
426 0.15
427 0.14
428 0.13
429 0.12
430 0.12
431 0.12
432 0.12
433 0.11
434 0.14
435 0.18
436 0.24
437 0.28
438 0.33
439 0.35
440 0.38
441 0.41
442 0.42
443 0.46
444 0.46
445 0.47
446 0.44
447 0.42
448 0.37
449 0.33
450 0.3
451 0.23
452 0.26
453 0.27
454 0.26
455 0.33
456 0.39
457 0.46
458 0.51
459 0.54
460 0.5
461 0.48
462 0.57
463 0.58
464 0.6
465 0.55
466 0.54
467 0.53
468 0.54
469 0.58
470 0.52
471 0.46
472 0.4
473 0.44
474 0.45
475 0.45
476 0.41
477 0.35
478 0.31
479 0.3
480 0.33
481 0.29
482 0.27
483 0.32
484 0.31
485 0.34
486 0.35
487 0.34
488 0.3
489 0.33
490 0.3
491 0.22
492 0.21
493 0.16